Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UL33

Protein Details
Accession A0A316UL33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109LAKSRRSRKEPHPTGPCTKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MALRKKVSLRLSEMQCLLCQLILCAPCPAQHGVVTRIAKKPVELSRSWRLSVVWKWLSGDACVVSHVNTAPVPPAPIVSERSSIGFEAMLAKSRRSRKEPHPTGPCTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.36
4 0.28
5 0.2
6 0.16
7 0.11
8 0.13
9 0.13
10 0.13
11 0.13
12 0.13
13 0.14
14 0.17
15 0.18
16 0.15
17 0.17
18 0.19
19 0.2
20 0.26
21 0.28
22 0.28
23 0.3
24 0.31
25 0.29
26 0.26
27 0.3
28 0.29
29 0.31
30 0.29
31 0.33
32 0.39
33 0.41
34 0.41
35 0.35
36 0.3
37 0.3
38 0.31
39 0.32
40 0.24
41 0.22
42 0.22
43 0.24
44 0.23
45 0.18
46 0.17
47 0.1
48 0.08
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.11
64 0.14
65 0.15
66 0.17
67 0.17
68 0.18
69 0.18
70 0.17
71 0.15
72 0.12
73 0.1
74 0.12
75 0.12
76 0.17
77 0.17
78 0.2
79 0.27
80 0.35
81 0.43
82 0.44
83 0.52
84 0.57
85 0.67
86 0.74
87 0.77
88 0.79
89 0.78