Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UBD3

Protein Details
Accession A0A316UBD3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-46IMRWQRGRAGRYRRRRNKDTERKHVRRLPQBasic
NLS Segment(s)
PositionSequence
22-43RGRAGRYRRRRNKDTERKHVRR
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRLRLKSELNCPWYWAIMRWQRGRAGRYRRRRNKDTERKHVRRLPQATHDTIRHDTTLHDSKRSRSRSSLDHSIFCVCVCVCVWNRVPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.3
4 0.32
5 0.4
6 0.41
7 0.43
8 0.47
9 0.51
10 0.53
11 0.53
12 0.56
13 0.58
14 0.65
15 0.73
16 0.78
17 0.82
18 0.85
19 0.86
20 0.86
21 0.88
22 0.87
23 0.86
24 0.87
25 0.83
26 0.85
27 0.8
28 0.75
29 0.73
30 0.68
31 0.61
32 0.58
33 0.57
34 0.51
35 0.49
36 0.44
37 0.38
38 0.36
39 0.33
40 0.25
41 0.21
42 0.18
43 0.22
44 0.29
45 0.26
46 0.3
47 0.3
48 0.37
49 0.46
50 0.5
51 0.47
52 0.44
53 0.47
54 0.49
55 0.55
56 0.59
57 0.53
58 0.5
59 0.48
60 0.45
61 0.4
62 0.33
63 0.27
64 0.17
65 0.15
66 0.14
67 0.18
68 0.18
69 0.25