Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UCY5

Protein Details
Accession A0A316UCY5   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKHydrophilic
NLS Segment(s)
PositionSequence
53-61RRYDRKQKG
67-68KP
70-75FHKKAK
Subcellular Location(s) mito 16, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLTLRTSTLTLYRVNVPKTRRTYCKGKTCKKHTPHKVTQYKTGKASLFAQGKRRYDRKQKGYGGQTKPVFHKKAKTTKKVVLRLECTSCKYRSHMALKRCKHFELGGDKKQKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.4
4 0.46
5 0.53
6 0.58
7 0.57
8 0.58
9 0.64
10 0.68
11 0.75
12 0.76
13 0.78
14 0.81
15 0.83
16 0.87
17 0.86
18 0.87
19 0.87
20 0.87
21 0.86
22 0.87
23 0.87
24 0.8
25 0.81
26 0.78
27 0.71
28 0.63
29 0.58
30 0.48
31 0.4
32 0.39
33 0.36
34 0.35
35 0.33
36 0.38
37 0.4
38 0.44
39 0.48
40 0.52
41 0.52
42 0.56
43 0.64
44 0.63
45 0.67
46 0.67
47 0.68
48 0.7
49 0.72
50 0.65
51 0.62
52 0.57
53 0.5
54 0.51
55 0.51
56 0.47
57 0.4
58 0.44
59 0.45
60 0.53
61 0.6
62 0.63
63 0.63
64 0.66
65 0.73
66 0.73
67 0.72
68 0.69
69 0.64
70 0.61
71 0.6
72 0.56
73 0.51
74 0.48
75 0.43
76 0.38
77 0.37
78 0.37
79 0.4
80 0.47
81 0.49
82 0.54
83 0.62
84 0.68
85 0.73
86 0.72
87 0.65
88 0.59
89 0.54
90 0.51
91 0.52
92 0.53
93 0.54
94 0.58
95 0.57
96 0.55
97 0.55
98 0.5