Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U7N3

Protein Details
Accession A0A316U7N3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLAIKKPRNARSKRAMDKRQPQLNEGHydrophilic
NLS Segment(s)
PositionSequence
6-14KPRNARSKR
430-442KGAANGKKRGRKA
Subcellular Location(s) nucl 19, mito_nucl 12.999, cyto_nucl 12.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR039770  Rpf2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0019843  F:rRNA binding  
GO:0000470  P:maturation of LSU-rRNA  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MLAIKKPRNARSKRAMDKRQPQLNEGVKSALIVNASHSSALVSKAIHQLSTLKKPHAIPFTKKKSNDVNPFVDSGSIEFWCAKNDTPLMLVGDSRKKRKDNLTWIRLFDGRVLDMLEMGIDSMKGVEEFKPPTLPDIGSRPIFQFSGPQFSADAASLYPAHAHLKSLLLDFYRGEEVLENGIPTGGSVALQNGLQFVISVTAGPIDEQTGGAGSSTGQGTSLADLYAAGAASSSTNGIGSSSSPSIDTSASGAKIYFRTYSLVVPPKTPARAIPSSFELHECGPTFDFTLRRRQAADATLLSHSLKRGKTQAEKNRQGKSDTYKKNIETDEMGDMVGRIHVGKQDLTNLQTRKMKGLKAGKEEDEDEDDSDEELEALSEDDDDEEDAYMGLGNDSDEDEEEEDEDEELEMEQLAAGSADEDDEPAESAPKGAANGKKRGRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.91
5 0.91
6 0.89
7 0.82
8 0.74
9 0.73
10 0.71
11 0.63
12 0.55
13 0.46
14 0.37
15 0.35
16 0.32
17 0.24
18 0.16
19 0.13
20 0.15
21 0.16
22 0.16
23 0.15
24 0.15
25 0.14
26 0.14
27 0.16
28 0.14
29 0.12
30 0.15
31 0.22
32 0.23
33 0.22
34 0.21
35 0.26
36 0.32
37 0.41
38 0.42
39 0.38
40 0.42
41 0.46
42 0.53
43 0.56
44 0.56
45 0.56
46 0.62
47 0.7
48 0.74
49 0.72
50 0.71
51 0.72
52 0.74
53 0.75
54 0.71
55 0.66
56 0.6
57 0.59
58 0.53
59 0.43
60 0.33
61 0.24
62 0.18
63 0.13
64 0.12
65 0.12
66 0.12
67 0.14
68 0.15
69 0.15
70 0.17
71 0.18
72 0.18
73 0.17
74 0.18
75 0.17
76 0.16
77 0.17
78 0.18
79 0.26
80 0.31
81 0.38
82 0.43
83 0.45
84 0.51
85 0.6
86 0.65
87 0.67
88 0.72
89 0.75
90 0.73
91 0.71
92 0.67
93 0.59
94 0.49
95 0.41
96 0.32
97 0.22
98 0.18
99 0.17
100 0.13
101 0.12
102 0.11
103 0.08
104 0.05
105 0.05
106 0.04
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.07
114 0.11
115 0.14
116 0.15
117 0.17
118 0.17
119 0.19
120 0.2
121 0.19
122 0.18
123 0.21
124 0.24
125 0.22
126 0.23
127 0.22
128 0.22
129 0.21
130 0.19
131 0.21
132 0.18
133 0.24
134 0.23
135 0.23
136 0.21
137 0.21
138 0.22
139 0.15
140 0.14
141 0.07
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.09
148 0.09
149 0.1
150 0.09
151 0.11
152 0.12
153 0.12
154 0.13
155 0.11
156 0.11
157 0.11
158 0.12
159 0.11
160 0.1
161 0.09
162 0.08
163 0.08
164 0.09
165 0.09
166 0.07
167 0.06
168 0.06
169 0.06
170 0.05
171 0.05
172 0.03
173 0.03
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.03
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.05
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.07
228 0.07
229 0.07
230 0.07
231 0.08
232 0.09
233 0.09
234 0.08
235 0.07
236 0.09
237 0.09
238 0.09
239 0.09
240 0.09
241 0.1
242 0.11
243 0.1
244 0.1
245 0.11
246 0.12
247 0.14
248 0.19
249 0.25
250 0.24
251 0.24
252 0.26
253 0.28
254 0.28
255 0.26
256 0.23
257 0.23
258 0.27
259 0.27
260 0.27
261 0.27
262 0.28
263 0.28
264 0.27
265 0.21
266 0.17
267 0.18
268 0.16
269 0.14
270 0.13
271 0.13
272 0.13
273 0.14
274 0.19
275 0.18
276 0.28
277 0.29
278 0.29
279 0.31
280 0.31
281 0.32
282 0.3
283 0.32
284 0.22
285 0.22
286 0.21
287 0.21
288 0.2
289 0.17
290 0.16
291 0.18
292 0.18
293 0.19
294 0.24
295 0.3
296 0.39
297 0.48
298 0.57
299 0.62
300 0.71
301 0.75
302 0.76
303 0.72
304 0.66
305 0.62
306 0.6
307 0.6
308 0.58
309 0.57
310 0.56
311 0.55
312 0.58
313 0.54
314 0.47
315 0.39
316 0.34
317 0.29
318 0.23
319 0.21
320 0.15
321 0.14
322 0.11
323 0.09
324 0.07
325 0.05
326 0.06
327 0.08
328 0.1
329 0.11
330 0.12
331 0.17
332 0.2
333 0.22
334 0.28
335 0.27
336 0.32
337 0.37
338 0.37
339 0.4
340 0.42
341 0.42
342 0.43
343 0.52
344 0.53
345 0.55
346 0.6
347 0.54
348 0.53
349 0.52
350 0.46
351 0.41
352 0.35
353 0.28
354 0.23
355 0.21
356 0.18
357 0.16
358 0.13
359 0.08
360 0.07
361 0.06
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.06
374 0.06
375 0.06
376 0.06
377 0.06
378 0.05
379 0.05
380 0.06
381 0.06
382 0.07
383 0.07
384 0.09
385 0.1
386 0.1
387 0.1
388 0.11
389 0.11
390 0.1
391 0.1
392 0.08
393 0.07
394 0.07
395 0.07
396 0.06
397 0.05
398 0.05
399 0.05
400 0.05
401 0.04
402 0.04
403 0.04
404 0.04
405 0.05
406 0.05
407 0.06
408 0.06
409 0.07
410 0.08
411 0.08
412 0.1
413 0.09
414 0.09
415 0.1
416 0.11
417 0.13
418 0.19
419 0.26
420 0.32
421 0.42
422 0.51