Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UHL1

Protein Details
Accession A0A316UHL1   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-40SERGTDKGKGSRKKPKPFTREEDLBasic
NLS Segment(s)
PositionSequence
22-33DKGKGSRKKPKP
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPPKRKREQSEDGVPESERGTDKGKGSRKKPKPFTREEDLIIIDYLDSLKKFADLARLFPDRVPFSVRQRVVLIFAKMRGLAGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.36
4 0.3
5 0.2
6 0.17
7 0.18
8 0.2
9 0.23
10 0.3
11 0.39
12 0.44
13 0.51
14 0.6
15 0.66
16 0.73
17 0.8
18 0.82
19 0.82
20 0.82
21 0.81
22 0.78
23 0.71
24 0.62
25 0.53
26 0.43
27 0.35
28 0.27
29 0.2
30 0.11
31 0.08
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.15
41 0.15
42 0.18
43 0.23
44 0.25
45 0.26
46 0.27
47 0.31
48 0.24
49 0.25
50 0.28
51 0.26
52 0.32
53 0.41
54 0.4
55 0.37
56 0.38
57 0.37
58 0.37
59 0.38
60 0.34
61 0.28
62 0.28
63 0.27
64 0.25
65 0.25