Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UAV1

Protein Details
Accession A0A316UAV1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
201-222PEPPVAERTKQREREREPERQABasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0007034  P:vacuolar transport  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGASSSTPKITSHDRAILDLKLQRDRIRQYQKKLLTIEGREKEAARLLLARGDKARALSALRRGKYQRSMLEKTDGQLKTLEELVSNIEFSQIQASVYHGLAQGNQVLKEIHKELNTESVEKLLEETAEAQAHQREVDELLATRMTADEEAEVQAELDALEREAAGVSIVPPSTVAETDRQKVQAPQLPDAPTADPVAASPEPPVAERTKQREREREPERQAMLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.44
4 0.41
5 0.39
6 0.36
7 0.34
8 0.34
9 0.37
10 0.39
11 0.43
12 0.49
13 0.54
14 0.61
15 0.65
16 0.67
17 0.73
18 0.74
19 0.73
20 0.68
21 0.65
22 0.61
23 0.59
24 0.61
25 0.54
26 0.51
27 0.46
28 0.45
29 0.39
30 0.35
31 0.3
32 0.21
33 0.19
34 0.16
35 0.2
36 0.2
37 0.2
38 0.18
39 0.19
40 0.18
41 0.18
42 0.18
43 0.14
44 0.17
45 0.19
46 0.27
47 0.33
48 0.33
49 0.38
50 0.4
51 0.45
52 0.49
53 0.52
54 0.49
55 0.5
56 0.54
57 0.5
58 0.53
59 0.47
60 0.41
61 0.43
62 0.36
63 0.29
64 0.26
65 0.24
66 0.19
67 0.2
68 0.19
69 0.1
70 0.1
71 0.11
72 0.1
73 0.1
74 0.08
75 0.07
76 0.07
77 0.07
78 0.08
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.09
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.1
92 0.1
93 0.09
94 0.09
95 0.09
96 0.11
97 0.13
98 0.12
99 0.12
100 0.13
101 0.13
102 0.2
103 0.2
104 0.19
105 0.17
106 0.16
107 0.15
108 0.14
109 0.14
110 0.07
111 0.06
112 0.05
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.06
156 0.06
157 0.05
158 0.06
159 0.07
160 0.08
161 0.08
162 0.1
163 0.14
164 0.19
165 0.22
166 0.25
167 0.25
168 0.26
169 0.29
170 0.35
171 0.34
172 0.34
173 0.35
174 0.37
175 0.38
176 0.37
177 0.36
178 0.3
179 0.26
180 0.23
181 0.19
182 0.13
183 0.11
184 0.16
185 0.14
186 0.13
187 0.13
188 0.14
189 0.15
190 0.16
191 0.19
192 0.18
193 0.25
194 0.33
195 0.41
196 0.49
197 0.58
198 0.67
199 0.74
200 0.78
201 0.81
202 0.8
203 0.82
204 0.8
205 0.79