Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316U8H4

Protein Details
Accession A0A316U8H4   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
174-193SSHTQHPSPKSKHKAVPFPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013963  DASH_Dad2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0072686  C:mitotic spindle  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08654  DASH_Dad2  
Amino Acid Sequences MSRPSTMYADQPHPTRSSLFPGGGPGSSSSTSGSGASTSRLQAKQQELEGLKELREYSARLVRELETMGQGLEAIKKGEESEYGRLALAHRGEERRGERDHHSAPRDLELRQLTAFPHPRLPTTTGVAQVMSSWQTVFRGIQVAQGESASPLLSPPLSPITHLPLTLFSPLPNSSHTQHPSPKSKHKAVPFPTQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.32
4 0.34
5 0.33
6 0.31
7 0.27
8 0.29
9 0.29
10 0.26
11 0.25
12 0.19
13 0.18
14 0.17
15 0.18
16 0.15
17 0.14
18 0.15
19 0.14
20 0.12
21 0.1
22 0.1
23 0.12
24 0.12
25 0.14
26 0.19
27 0.21
28 0.22
29 0.28
30 0.32
31 0.33
32 0.33
33 0.38
34 0.32
35 0.33
36 0.35
37 0.3
38 0.24
39 0.22
40 0.22
41 0.16
42 0.16
43 0.15
44 0.16
45 0.2
46 0.21
47 0.2
48 0.21
49 0.21
50 0.21
51 0.21
52 0.17
53 0.12
54 0.11
55 0.1
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.09
67 0.11
68 0.14
69 0.14
70 0.15
71 0.15
72 0.15
73 0.15
74 0.15
75 0.13
76 0.11
77 0.13
78 0.14
79 0.15
80 0.19
81 0.2
82 0.21
83 0.22
84 0.24
85 0.25
86 0.29
87 0.33
88 0.34
89 0.35
90 0.33
91 0.33
92 0.34
93 0.32
94 0.26
95 0.26
96 0.21
97 0.2
98 0.18
99 0.18
100 0.14
101 0.2
102 0.24
103 0.2
104 0.25
105 0.24
106 0.25
107 0.28
108 0.3
109 0.26
110 0.25
111 0.25
112 0.22
113 0.21
114 0.2
115 0.17
116 0.13
117 0.12
118 0.1
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.1
127 0.1
128 0.14
129 0.15
130 0.15
131 0.14
132 0.14
133 0.13
134 0.11
135 0.11
136 0.07
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.08
143 0.12
144 0.13
145 0.14
146 0.16
147 0.22
148 0.22
149 0.23
150 0.21
151 0.18
152 0.2
153 0.22
154 0.2
155 0.14
156 0.16
157 0.18
158 0.18
159 0.19
160 0.21
161 0.21
162 0.3
163 0.34
164 0.37
165 0.44
166 0.51
167 0.59
168 0.63
169 0.71
170 0.72
171 0.77
172 0.78
173 0.79
174 0.81
175 0.77