Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U4T2

Protein Details
Accession A0A316U4T2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
376-401HSAWREWRREEIEKKRKQQEEGKGAKBasic
NLS Segment(s)
PositionSequence
387-401IEKKRKQQEEGKGAK
428-430RRK
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030231  Gpn2  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17871  GPN2  
Amino Acid Sequences MPFGQIVGSPGSGKTTYCNGVQQFLGALKRPNVHIVNLDFANSHLPYPCAIDVNSLISVPDVMVELDLGPNGAMMYCIEYLEENIDWLLTRLKELGEDAYVVFDLPGQVEISTNHPSLGRIIRTLEKQADFRLVALHLLDSSHILDPSRYVSLLLLSLRAMLSLELPHINVLTKVDLLGQASGGELPFPLDFYTDPSPAQLAPYLESHSTFLHRARYSSLNEKILEIIDDFSLVSFETLAVEDKESMWRLVRLVDKVGGWVFVHAGEMDLAGGARGEEDDDDDGEEEQMPSQMRAALEERYLDGNKPSGSAASALSLFTTLDSGAPLGWGSAEDVQERYVDSFKDSGNAAGTGARGGAAPRMTEEEFEKQEEERIHSAWREWRREEIEKKRKQQEEGKGAKEQSGQMKKGGEQDSRGLQRDGMNIKERRKRET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.23
4 0.24
5 0.31
6 0.28
7 0.31
8 0.31
9 0.28
10 0.24
11 0.25
12 0.26
13 0.22
14 0.25
15 0.27
16 0.3
17 0.31
18 0.37
19 0.36
20 0.35
21 0.38
22 0.35
23 0.36
24 0.33
25 0.32
26 0.24
27 0.22
28 0.25
29 0.19
30 0.18
31 0.14
32 0.15
33 0.15
34 0.19
35 0.19
36 0.17
37 0.16
38 0.18
39 0.18
40 0.2
41 0.2
42 0.16
43 0.15
44 0.12
45 0.12
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.11
69 0.1
70 0.08
71 0.08
72 0.08
73 0.07
74 0.08
75 0.12
76 0.09
77 0.1
78 0.11
79 0.11
80 0.12
81 0.13
82 0.14
83 0.1
84 0.11
85 0.1
86 0.1
87 0.1
88 0.09
89 0.08
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.12
99 0.15
100 0.15
101 0.15
102 0.15
103 0.16
104 0.19
105 0.23
106 0.2
107 0.18
108 0.21
109 0.24
110 0.26
111 0.3
112 0.31
113 0.29
114 0.29
115 0.29
116 0.3
117 0.26
118 0.24
119 0.21
120 0.16
121 0.15
122 0.13
123 0.12
124 0.07
125 0.07
126 0.07
127 0.06
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.11
135 0.11
136 0.1
137 0.09
138 0.09
139 0.09
140 0.11
141 0.1
142 0.08
143 0.07
144 0.08
145 0.07
146 0.07
147 0.07
148 0.05
149 0.06
150 0.05
151 0.07
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.05
168 0.06
169 0.06
170 0.05
171 0.04
172 0.03
173 0.04
174 0.04
175 0.05
176 0.04
177 0.05
178 0.05
179 0.1
180 0.13
181 0.13
182 0.13
183 0.12
184 0.13
185 0.12
186 0.13
187 0.11
188 0.08
189 0.09
190 0.1
191 0.11
192 0.11
193 0.11
194 0.12
195 0.11
196 0.12
197 0.12
198 0.13
199 0.18
200 0.18
201 0.18
202 0.2
203 0.23
204 0.25
205 0.3
206 0.32
207 0.29
208 0.29
209 0.29
210 0.26
211 0.22
212 0.2
213 0.13
214 0.1
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.04
226 0.05
227 0.05
228 0.05
229 0.06
230 0.06
231 0.08
232 0.09
233 0.09
234 0.09
235 0.1
236 0.1
237 0.13
238 0.16
239 0.15
240 0.16
241 0.17
242 0.16
243 0.16
244 0.16
245 0.13
246 0.1
247 0.09
248 0.08
249 0.07
250 0.07
251 0.05
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.02
261 0.02
262 0.02
263 0.03
264 0.03
265 0.04
266 0.05
267 0.05
268 0.06
269 0.06
270 0.07
271 0.07
272 0.07
273 0.06
274 0.06
275 0.08
276 0.08
277 0.08
278 0.08
279 0.1
280 0.09
281 0.12
282 0.13
283 0.13
284 0.13
285 0.14
286 0.15
287 0.16
288 0.17
289 0.15
290 0.15
291 0.16
292 0.16
293 0.16
294 0.15
295 0.12
296 0.11
297 0.12
298 0.11
299 0.09
300 0.09
301 0.08
302 0.08
303 0.08
304 0.07
305 0.06
306 0.06
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.04
315 0.04
316 0.04
317 0.06
318 0.08
319 0.09
320 0.1
321 0.11
322 0.11
323 0.12
324 0.12
325 0.13
326 0.12
327 0.11
328 0.13
329 0.14
330 0.14
331 0.16
332 0.16
333 0.15
334 0.15
335 0.15
336 0.13
337 0.12
338 0.12
339 0.09
340 0.09
341 0.08
342 0.06
343 0.07
344 0.1
345 0.1
346 0.1
347 0.11
348 0.16
349 0.16
350 0.17
351 0.21
352 0.24
353 0.25
354 0.27
355 0.27
356 0.23
357 0.27
358 0.28
359 0.3
360 0.26
361 0.25
362 0.27
363 0.27
364 0.31
365 0.35
366 0.41
367 0.43
368 0.43
369 0.5
370 0.54
371 0.62
372 0.68
373 0.71
374 0.72
375 0.75
376 0.82
377 0.84
378 0.83
379 0.81
380 0.81
381 0.8
382 0.8
383 0.79
384 0.74
385 0.71
386 0.66
387 0.62
388 0.56
389 0.51
390 0.5
391 0.5
392 0.47
393 0.44
394 0.46
395 0.45
396 0.5
397 0.52
398 0.45
399 0.4
400 0.44
401 0.49
402 0.52
403 0.53
404 0.45
405 0.41
406 0.41
407 0.45
408 0.44
409 0.42
410 0.45
411 0.48
412 0.56
413 0.63