Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316UBY6

Protein Details
Accession A0A316UBY6   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SFGKRHTKSHTVCRRCNKRSFHRQHKTCASCHydrophilic
NLS Segment(s)
PositionSequence
52-76KAKRRRTTGTGRMRYLKTVPRKAKN
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSFGKRHTKSHTVCRRCNKRSFHRQHKTCASCGYPAAKIRSYEWGQKAKRRRTTGTGRMRYLKTVPRKAKNGFRTGVATKKAVAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.7
4 0.69
5 0.76
6 0.8
7 0.82
8 0.8
9 0.83
10 0.82
11 0.82
12 0.84
13 0.86
14 0.86
15 0.87
16 0.84
17 0.84
18 0.84
19 0.77
20 0.68
21 0.61
22 0.52
23 0.42
24 0.4
25 0.33
26 0.26
27 0.26
28 0.27
29 0.25
30 0.24
31 0.23
32 0.28
33 0.27
34 0.3
35 0.32
36 0.37
37 0.38
38 0.45
39 0.53
40 0.56
41 0.62
42 0.62
43 0.61
44 0.6
45 0.67
46 0.71
47 0.72
48 0.7
49 0.66
50 0.66
51 0.63
52 0.58
53 0.53
54 0.51
55 0.5
56 0.53
57 0.58
58 0.6
59 0.67
60 0.71
61 0.76
62 0.76
63 0.74
64 0.65
65 0.59
66 0.57
67 0.54
68 0.55
69 0.49
70 0.41
71 0.35
72 0.37