Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U4M9

Protein Details
Accession A0A316U4M9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
246-270MVGPPRTKRESKKKAKSWEIPRKIFHydrophilic
NLS Segment(s)
PositionSequence
227-264GRKNREGLRRRAEQNQVEKMVGPPRTKRESKKKAKSWE
Subcellular Location(s) plas 11, mito 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
Amino Acid Sequences MSHPQQRRHLSISNPFRKSSVSSSSTASSSGSNGPQLKPFSPRPSTLDVPEEYPSSSSTAKMSTKGSKDASGASKRAASKSANRSVGDASSASADPSSSQVGVRRHLRRDSSLTEKGAAVLRAMKRAPEDETPDISPSDSPHTGNGDADGATDISVAPLPPPKANGGLKSPLSDDGYDPETVASPGRRPKPFVFTALDTAGDDNGTTGDVSRAGSFIGLSEAEKAIGRKNREGLRRRAEQNQVEKMVGPPRTKRESKKKAKSWEIPRKIFHSSIGFIVLYMYLNDFDLSSVVRTMSTFLVIVVTADVIRLNYRPFETFYESVLGFLMREAEKERVNGVVWYLIGVIFSLHFYPADVACVSVMMLSWADTCASTFGRLFGRYTPPLPSPPFAARKSLSGFLAAVVAGSLTALLFWGTNIAKSHERFDGVSWSPVHSIFGATSAGAYHSGWNGWAWGFRGHLSPILASGGYKGRMSAVLQTASHATGNMMSNQIITSVPGMPLWALCIGSGLVAATAEGLELGGVDDNLSLPILSGFGMWAMLFAWGRAASLWVGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.63
3 0.57
4 0.54
5 0.51
6 0.47
7 0.45
8 0.39
9 0.37
10 0.4
11 0.41
12 0.39
13 0.34
14 0.29
15 0.2
16 0.19
17 0.21
18 0.2
19 0.24
20 0.27
21 0.28
22 0.33
23 0.37
24 0.37
25 0.39
26 0.45
27 0.48
28 0.49
29 0.51
30 0.51
31 0.54
32 0.55
33 0.52
34 0.5
35 0.43
36 0.41
37 0.39
38 0.34
39 0.28
40 0.24
41 0.21
42 0.19
43 0.18
44 0.16
45 0.16
46 0.2
47 0.21
48 0.24
49 0.28
50 0.33
51 0.36
52 0.41
53 0.42
54 0.39
55 0.39
56 0.42
57 0.45
58 0.43
59 0.41
60 0.37
61 0.4
62 0.4
63 0.41
64 0.39
65 0.35
66 0.38
67 0.46
68 0.53
69 0.53
70 0.51
71 0.51
72 0.49
73 0.45
74 0.37
75 0.27
76 0.19
77 0.16
78 0.16
79 0.14
80 0.12
81 0.11
82 0.09
83 0.11
84 0.12
85 0.1
86 0.11
87 0.17
88 0.2
89 0.27
90 0.35
91 0.4
92 0.45
93 0.51
94 0.54
95 0.54
96 0.57
97 0.57
98 0.56
99 0.55
100 0.51
101 0.46
102 0.42
103 0.37
104 0.34
105 0.28
106 0.2
107 0.21
108 0.21
109 0.24
110 0.24
111 0.24
112 0.23
113 0.25
114 0.28
115 0.26
116 0.31
117 0.3
118 0.33
119 0.33
120 0.32
121 0.3
122 0.27
123 0.23
124 0.18
125 0.2
126 0.18
127 0.17
128 0.18
129 0.21
130 0.21
131 0.21
132 0.2
133 0.15
134 0.13
135 0.13
136 0.11
137 0.08
138 0.07
139 0.07
140 0.06
141 0.05
142 0.06
143 0.05
144 0.06
145 0.1
146 0.12
147 0.12
148 0.14
149 0.15
150 0.21
151 0.24
152 0.26
153 0.26
154 0.3
155 0.3
156 0.29
157 0.29
158 0.25
159 0.25
160 0.22
161 0.18
162 0.16
163 0.17
164 0.16
165 0.15
166 0.12
167 0.11
168 0.11
169 0.12
170 0.11
171 0.13
172 0.2
173 0.28
174 0.3
175 0.34
176 0.37
177 0.43
178 0.43
179 0.44
180 0.4
181 0.35
182 0.36
183 0.32
184 0.29
185 0.22
186 0.2
187 0.15
188 0.11
189 0.08
190 0.05
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.06
209 0.07
210 0.08
211 0.08
212 0.13
213 0.17
214 0.2
215 0.21
216 0.28
217 0.34
218 0.42
219 0.49
220 0.52
221 0.55
222 0.59
223 0.6
224 0.61
225 0.63
226 0.61
227 0.61
228 0.57
229 0.51
230 0.44
231 0.41
232 0.36
233 0.33
234 0.31
235 0.26
236 0.25
237 0.3
238 0.37
239 0.42
240 0.49
241 0.55
242 0.61
243 0.7
244 0.76
245 0.78
246 0.81
247 0.84
248 0.85
249 0.85
250 0.85
251 0.83
252 0.77
253 0.71
254 0.65
255 0.59
256 0.5
257 0.41
258 0.33
259 0.24
260 0.2
261 0.19
262 0.15
263 0.12
264 0.11
265 0.09
266 0.06
267 0.05
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.05
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.04
290 0.04
291 0.03
292 0.03
293 0.04
294 0.03
295 0.04
296 0.05
297 0.06
298 0.07
299 0.09
300 0.1
301 0.12
302 0.15
303 0.2
304 0.2
305 0.21
306 0.22
307 0.2
308 0.19
309 0.17
310 0.14
311 0.08
312 0.07
313 0.09
314 0.06
315 0.07
316 0.09
317 0.12
318 0.13
319 0.13
320 0.14
321 0.13
322 0.13
323 0.13
324 0.11
325 0.09
326 0.08
327 0.08
328 0.07
329 0.06
330 0.05
331 0.05
332 0.05
333 0.04
334 0.04
335 0.04
336 0.05
337 0.04
338 0.05
339 0.06
340 0.06
341 0.08
342 0.07
343 0.07
344 0.07
345 0.07
346 0.06
347 0.05
348 0.05
349 0.04
350 0.04
351 0.04
352 0.04
353 0.05
354 0.05
355 0.05
356 0.05
357 0.07
358 0.07
359 0.08
360 0.08
361 0.1
362 0.13
363 0.14
364 0.15
365 0.17
366 0.22
367 0.23
368 0.25
369 0.26
370 0.26
371 0.3
372 0.32
373 0.29
374 0.28
375 0.32
376 0.38
377 0.35
378 0.38
379 0.34
380 0.35
381 0.37
382 0.35
383 0.29
384 0.23
385 0.22
386 0.17
387 0.16
388 0.12
389 0.09
390 0.06
391 0.05
392 0.04
393 0.03
394 0.03
395 0.02
396 0.02
397 0.02
398 0.03
399 0.03
400 0.03
401 0.07
402 0.07
403 0.1
404 0.11
405 0.15
406 0.2
407 0.21
408 0.25
409 0.24
410 0.25
411 0.24
412 0.24
413 0.28
414 0.24
415 0.28
416 0.25
417 0.25
418 0.24
419 0.24
420 0.23
421 0.16
422 0.15
423 0.1
424 0.11
425 0.09
426 0.08
427 0.08
428 0.07
429 0.08
430 0.08
431 0.08
432 0.08
433 0.08
434 0.09
435 0.09
436 0.09
437 0.09
438 0.09
439 0.11
440 0.11
441 0.12
442 0.13
443 0.14
444 0.16
445 0.16
446 0.18
447 0.18
448 0.16
449 0.15
450 0.15
451 0.14
452 0.12
453 0.13
454 0.14
455 0.15
456 0.15
457 0.14
458 0.14
459 0.16
460 0.17
461 0.2
462 0.21
463 0.22
464 0.22
465 0.23
466 0.24
467 0.23
468 0.22
469 0.16
470 0.12
471 0.13
472 0.15
473 0.15
474 0.15
475 0.14
476 0.14
477 0.14
478 0.14
479 0.11
480 0.1
481 0.1
482 0.1
483 0.1
484 0.1
485 0.1
486 0.1
487 0.09
488 0.11
489 0.1
490 0.08
491 0.08
492 0.09
493 0.08
494 0.08
495 0.08
496 0.06
497 0.05
498 0.05
499 0.05
500 0.04
501 0.04
502 0.04
503 0.03
504 0.03
505 0.03
506 0.03
507 0.04
508 0.04
509 0.04
510 0.05
511 0.05
512 0.05
513 0.06
514 0.06
515 0.05
516 0.05
517 0.06
518 0.06
519 0.06
520 0.05
521 0.05
522 0.05
523 0.06
524 0.05
525 0.05
526 0.05
527 0.08
528 0.08
529 0.08
530 0.1
531 0.1
532 0.1
533 0.1
534 0.12
535 0.09