Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UBI0

Protein Details
Accession A0A316UBI0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
120-148TDEAKTNKNRAKRDKKKLAREKAKLQSAEHydrophilic
NLS Segment(s)
PositionSequence
126-164NKNRAKRDKKKLAREKAKLQSAEANGKSTGADAKRKRAE
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSSQAGPSSSSSPPPAPAVQKSKHKLTPAEQQALALEKLLANPDREIRLPSGPKEKTLRAPREMMKNVSGSSAGAGSGEFHVYKHARRREYERIKLLEEKAAKEKSSSAFLISQAQQAATDEAKTNKNRAKRDKKKLAREKAKLQSAEANGKSTGADAKRKRAEDQGEAGKDGEEKKLKAAPGAEGFTFRPREEEESEGEEEEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.32
4 0.39
5 0.44
6 0.47
7 0.56
8 0.59
9 0.64
10 0.64
11 0.64
12 0.62
13 0.59
14 0.63
15 0.61
16 0.61
17 0.52
18 0.48
19 0.43
20 0.4
21 0.35
22 0.24
23 0.16
24 0.11
25 0.11
26 0.15
27 0.15
28 0.14
29 0.15
30 0.18
31 0.2
32 0.21
33 0.23
34 0.22
35 0.27
36 0.29
37 0.32
38 0.39
39 0.37
40 0.41
41 0.44
42 0.45
43 0.47
44 0.53
45 0.55
46 0.5
47 0.55
48 0.54
49 0.59
50 0.59
51 0.52
52 0.45
53 0.4
54 0.36
55 0.3
56 0.26
57 0.16
58 0.13
59 0.1
60 0.07
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.1
69 0.12
70 0.16
71 0.24
72 0.3
73 0.33
74 0.36
75 0.44
76 0.51
77 0.59
78 0.62
79 0.6
80 0.56
81 0.55
82 0.56
83 0.49
84 0.43
85 0.35
86 0.3
87 0.29
88 0.28
89 0.25
90 0.22
91 0.23
92 0.19
93 0.21
94 0.19
95 0.14
96 0.14
97 0.15
98 0.18
99 0.17
100 0.17
101 0.13
102 0.13
103 0.11
104 0.11
105 0.12
106 0.08
107 0.08
108 0.08
109 0.11
110 0.17
111 0.18
112 0.24
113 0.27
114 0.34
115 0.41
116 0.51
117 0.6
118 0.65
119 0.75
120 0.8
121 0.86
122 0.9
123 0.92
124 0.92
125 0.91
126 0.88
127 0.86
128 0.84
129 0.82
130 0.71
131 0.63
132 0.58
133 0.51
134 0.52
135 0.43
136 0.37
137 0.29
138 0.28
139 0.26
140 0.21
141 0.22
142 0.17
143 0.26
144 0.27
145 0.37
146 0.43
147 0.46
148 0.48
149 0.5
150 0.52
151 0.49
152 0.53
153 0.52
154 0.47
155 0.46
156 0.43
157 0.36
158 0.32
159 0.28
160 0.28
161 0.24
162 0.23
163 0.25
164 0.29
165 0.29
166 0.31
167 0.31
168 0.29
169 0.3
170 0.32
171 0.29
172 0.27
173 0.29
174 0.32
175 0.33
176 0.27
177 0.25
178 0.26
179 0.31
180 0.32
181 0.34
182 0.31
183 0.34
184 0.35
185 0.32