Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316U5H7

Protein Details
Accession A0A316U5H7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
475-495GSPTRVRRTSRDQRSHGPAAEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
IPR038772  Sph/SMPD2-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004767  F:sphingomyelin phosphodiesterase activity  
GO:0006665  P:sphingolipid metabolic process  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MSHPSSTSSPSAPSTLKILTLNVWGLAYISKARQFRIRYIAERLAEGDWDIVALQEIWVESDDWRFVSARCAERLPYTKFFYSGAFGSGLAILSRFPIFATHTQPYTLNGLPLNVGQGDWFVGKAAGSISIDLGDGILVDVFNTHTVAAGGEDGPEMLRAHRLMQAWELSKLVQNSAEKGRHAIAVGDFNSTPPSLPIAILRNLGSLSDAFLSTHPSLPPNAVTLPGQAALGSTTSPDPHLAIAKLGVTCDSPLNSWTEGKPLDGRARAAAGKRLDYIFYRGPYSADSEGQDPAARYTNHGRLKPVDCKVCFTERVPGSDMSCTDHFGVEATFEILPRSIGQATKDTALNTLADRDLTSTLNSAVSALGAYMHHCSKTQRSHLLGFCGCVTAALTLAIATPFLGYRGYNLFAAGAIVLAIAAGWGGTTLLYSGVIWGEWEKRALRTAIESMELDLSHLSQRQSLNRPNGQSREDGSPTRVRRTSRDQRSHGPAAEAESLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.26
4 0.24
5 0.23
6 0.21
7 0.24
8 0.23
9 0.19
10 0.18
11 0.15
12 0.14
13 0.13
14 0.13
15 0.12
16 0.15
17 0.21
18 0.23
19 0.26
20 0.34
21 0.37
22 0.42
23 0.49
24 0.52
25 0.5
26 0.56
27 0.6
28 0.54
29 0.51
30 0.46
31 0.37
32 0.3
33 0.26
34 0.18
35 0.11
36 0.1
37 0.08
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.1
49 0.12
50 0.11
51 0.13
52 0.13
53 0.12
54 0.19
55 0.25
56 0.27
57 0.29
58 0.31
59 0.32
60 0.38
61 0.45
62 0.45
63 0.44
64 0.45
65 0.43
66 0.42
67 0.42
68 0.36
69 0.31
70 0.25
71 0.21
72 0.16
73 0.14
74 0.14
75 0.13
76 0.12
77 0.09
78 0.08
79 0.06
80 0.07
81 0.07
82 0.07
83 0.06
84 0.08
85 0.12
86 0.16
87 0.22
88 0.24
89 0.25
90 0.26
91 0.27
92 0.27
93 0.28
94 0.25
95 0.2
96 0.17
97 0.17
98 0.16
99 0.16
100 0.15
101 0.1
102 0.09
103 0.07
104 0.07
105 0.08
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.08
146 0.08
147 0.1
148 0.14
149 0.15
150 0.15
151 0.17
152 0.21
153 0.2
154 0.21
155 0.2
156 0.16
157 0.18
158 0.17
159 0.16
160 0.15
161 0.14
162 0.17
163 0.23
164 0.25
165 0.22
166 0.24
167 0.24
168 0.21
169 0.2
170 0.19
171 0.13
172 0.15
173 0.16
174 0.16
175 0.14
176 0.14
177 0.15
178 0.13
179 0.12
180 0.08
181 0.09
182 0.08
183 0.08
184 0.1
185 0.13
186 0.14
187 0.15
188 0.15
189 0.14
190 0.13
191 0.13
192 0.11
193 0.08
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.11
200 0.11
201 0.13
202 0.12
203 0.13
204 0.13
205 0.14
206 0.14
207 0.11
208 0.1
209 0.1
210 0.1
211 0.09
212 0.09
213 0.09
214 0.08
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.07
227 0.08
228 0.08
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.07
235 0.06
236 0.07
237 0.07
238 0.07
239 0.06
240 0.07
241 0.09
242 0.09
243 0.1
244 0.1
245 0.12
246 0.12
247 0.13
248 0.14
249 0.14
250 0.18
251 0.18
252 0.18
253 0.16
254 0.17
255 0.19
256 0.18
257 0.21
258 0.18
259 0.18
260 0.18
261 0.18
262 0.18
263 0.16
264 0.2
265 0.18
266 0.18
267 0.18
268 0.17
269 0.17
270 0.17
271 0.19
272 0.16
273 0.14
274 0.14
275 0.14
276 0.14
277 0.14
278 0.14
279 0.11
280 0.11
281 0.14
282 0.13
283 0.15
284 0.2
285 0.28
286 0.33
287 0.34
288 0.35
289 0.36
290 0.41
291 0.46
292 0.46
293 0.45
294 0.4
295 0.43
296 0.44
297 0.43
298 0.4
299 0.33
300 0.36
301 0.3
302 0.33
303 0.32
304 0.29
305 0.26
306 0.26
307 0.25
308 0.2
309 0.19
310 0.18
311 0.15
312 0.14
313 0.13
314 0.12
315 0.11
316 0.07
317 0.07
318 0.07
319 0.06
320 0.06
321 0.07
322 0.07
323 0.07
324 0.07
325 0.09
326 0.09
327 0.1
328 0.12
329 0.15
330 0.16
331 0.18
332 0.19
333 0.17
334 0.16
335 0.16
336 0.15
337 0.12
338 0.13
339 0.11
340 0.1
341 0.1
342 0.1
343 0.11
344 0.11
345 0.11
346 0.1
347 0.1
348 0.1
349 0.1
350 0.09
351 0.07
352 0.06
353 0.06
354 0.05
355 0.05
356 0.05
357 0.06
358 0.08
359 0.1
360 0.1
361 0.12
362 0.15
363 0.22
364 0.31
365 0.37
366 0.41
367 0.44
368 0.5
369 0.51
370 0.55
371 0.48
372 0.41
373 0.34
374 0.28
375 0.23
376 0.17
377 0.15
378 0.08
379 0.08
380 0.06
381 0.06
382 0.05
383 0.06
384 0.06
385 0.05
386 0.05
387 0.05
388 0.05
389 0.05
390 0.06
391 0.06
392 0.08
393 0.11
394 0.13
395 0.13
396 0.13
397 0.13
398 0.12
399 0.12
400 0.09
401 0.06
402 0.04
403 0.04
404 0.03
405 0.03
406 0.02
407 0.02
408 0.02
409 0.02
410 0.02
411 0.02
412 0.02
413 0.02
414 0.03
415 0.03
416 0.04
417 0.04
418 0.04
419 0.05
420 0.05
421 0.05
422 0.06
423 0.08
424 0.11
425 0.12
426 0.16
427 0.17
428 0.18
429 0.23
430 0.23
431 0.22
432 0.24
433 0.27
434 0.25
435 0.26
436 0.25
437 0.22
438 0.23
439 0.21
440 0.17
441 0.13
442 0.13
443 0.13
444 0.16
445 0.15
446 0.18
447 0.22
448 0.3
449 0.38
450 0.46
451 0.53
452 0.56
453 0.63
454 0.66
455 0.68
456 0.63
457 0.59
458 0.54
459 0.52
460 0.5
461 0.46
462 0.43
463 0.46
464 0.48
465 0.53
466 0.54
467 0.5
468 0.53
469 0.61
470 0.67
471 0.69
472 0.75
473 0.72
474 0.77
475 0.82
476 0.81
477 0.73
478 0.65
479 0.56
480 0.5