Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316TYM7

Protein Details
Accession A0A316TYM7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-109MNKSAQSKKIRKRSYPLYKHTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MVRTARSSLWVVVTLATQTTVPLLRSPDLMLRQGTAGTKNVASNSESAICYDRTKELHATALKTKEVEWLVNQYPHIRLASLQVTTTVMNKSAQSKKIRKRSYPLYKHTVVPQRHKGDKKLQTNPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.09
5 0.07
6 0.09
7 0.1
8 0.1
9 0.12
10 0.14
11 0.14
12 0.16
13 0.17
14 0.2
15 0.21
16 0.23
17 0.21
18 0.19
19 0.19
20 0.19
21 0.19
22 0.16
23 0.14
24 0.13
25 0.14
26 0.14
27 0.14
28 0.15
29 0.14
30 0.13
31 0.13
32 0.14
33 0.13
34 0.13
35 0.14
36 0.14
37 0.13
38 0.14
39 0.15
40 0.13
41 0.15
42 0.16
43 0.15
44 0.2
45 0.2
46 0.22
47 0.23
48 0.24
49 0.23
50 0.21
51 0.21
52 0.19
53 0.18
54 0.16
55 0.13
56 0.16
57 0.18
58 0.19
59 0.19
60 0.16
61 0.16
62 0.17
63 0.16
64 0.12
65 0.1
66 0.12
67 0.15
68 0.14
69 0.13
70 0.12
71 0.13
72 0.13
73 0.14
74 0.11
75 0.1
76 0.11
77 0.12
78 0.19
79 0.25
80 0.31
81 0.39
82 0.48
83 0.57
84 0.66
85 0.74
86 0.73
87 0.75
88 0.8
89 0.81
90 0.82
91 0.8
92 0.77
93 0.71
94 0.68
95 0.68
96 0.66
97 0.63
98 0.62
99 0.65
100 0.65
101 0.72
102 0.74
103 0.73
104 0.75
105 0.77
106 0.77