Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CS55

Protein Details
Accession A1CS55    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-85DSAPASPEKRKRGRPRKNAYEGAAHydrophilic
NLS Segment(s)
PositionSequence
67-82SPEKRKRGRPRKNAYE
90-101GSPKKVKQGPAK
Subcellular Location(s) nucl 12, cyto 10.5, cyto_mito 8, mito 4.5
Family & Domain DBs
KEGG act:ACLA_032110  -  
Amino Acid Sequences MPMTWSPEADAKLLIGILNTSNVKLDLDALAKWMGPECTVYAIQHRIRKLQEKANSGSPGGDSAPASPEKRKRGRPRKNAYEGAAGEETGSPKKVKQGPAKKAVENEGEHGVSGGSGIEDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.08
3 0.07
4 0.07
5 0.1
6 0.1
7 0.1
8 0.11
9 0.11
10 0.11
11 0.1
12 0.11
13 0.09
14 0.1
15 0.1
16 0.11
17 0.11
18 0.1
19 0.1
20 0.11
21 0.09
22 0.08
23 0.09
24 0.08
25 0.1
26 0.11
27 0.11
28 0.13
29 0.2
30 0.24
31 0.27
32 0.28
33 0.29
34 0.33
35 0.4
36 0.41
37 0.42
38 0.45
39 0.46
40 0.47
41 0.48
42 0.46
43 0.38
44 0.34
45 0.26
46 0.2
47 0.15
48 0.13
49 0.07
50 0.06
51 0.08
52 0.1
53 0.12
54 0.16
55 0.22
56 0.3
57 0.38
58 0.47
59 0.57
60 0.66
61 0.76
62 0.82
63 0.86
64 0.88
65 0.89
66 0.84
67 0.76
68 0.72
69 0.61
70 0.55
71 0.44
72 0.34
73 0.26
74 0.21
75 0.2
76 0.13
77 0.15
78 0.11
79 0.11
80 0.2
81 0.25
82 0.33
83 0.42
84 0.52
85 0.59
86 0.69
87 0.74
88 0.69
89 0.67
90 0.64
91 0.6
92 0.51
93 0.45
94 0.39
95 0.34
96 0.3
97 0.27
98 0.21
99 0.14
100 0.12
101 0.09