Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L6I0

Protein Details
Accession E2L6I0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-41PKETPKETTERPKASKRKRDKKAAKGKKAVEHQSBasic
NLS Segment(s)
PositionSequence
17-36ERPKASKRKRDKKAAKGKKA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
KEGG mpr:MPER_01426  -  
Amino Acid Sequences METPKETPKETPKETTERPKASKRKRDKKAAKGKKAVEHQSKNQSHSVHEQQAISPIILRDPEATKKLLEVIIDSPNGRRAVSRLARTCKAFSKPALDVLWKELDSLTPVIGLFPSTLLKKARKPVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.69
4 0.69
5 0.7
6 0.73
7 0.78
8 0.8
9 0.83
10 0.84
11 0.85
12 0.86
13 0.91
14 0.91
15 0.92
16 0.92
17 0.93
18 0.91
19 0.9
20 0.86
21 0.83
22 0.81
23 0.8
24 0.79
25 0.74
26 0.71
27 0.73
28 0.7
29 0.65
30 0.61
31 0.52
32 0.44
33 0.44
34 0.43
35 0.37
36 0.35
37 0.32
38 0.28
39 0.31
40 0.29
41 0.22
42 0.16
43 0.12
44 0.1
45 0.1
46 0.1
47 0.08
48 0.1
49 0.13
50 0.13
51 0.14
52 0.13
53 0.13
54 0.14
55 0.13
56 0.11
57 0.1
58 0.11
59 0.12
60 0.13
61 0.13
62 0.12
63 0.16
64 0.16
65 0.15
66 0.13
67 0.12
68 0.21
69 0.27
70 0.34
71 0.37
72 0.42
73 0.46
74 0.49
75 0.5
76 0.46
77 0.45
78 0.42
79 0.37
80 0.37
81 0.34
82 0.37
83 0.36
84 0.32
85 0.28
86 0.28
87 0.3
88 0.24
89 0.23
90 0.18
91 0.16
92 0.17
93 0.17
94 0.13
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.07
101 0.07
102 0.11
103 0.11
104 0.16
105 0.21
106 0.27
107 0.34
108 0.43