Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CU04

Protein Details
Accession A1CU04    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-93DTETERKKEERKREREREREREREREREBasic
NLS Segment(s)
PositionSequence
88-130KEGRRKRASGNNDTETERKKEERKREREREREREREREREEER
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, extr 3
Family & Domain DBs
KEGG act:ACLA_084860  -  
Amino Acid Sequences MVEFSDQLDILCIPVGRLSPDGIAEANENYDDRIEGTVLVEGEGGGEEGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEDKEGRRKRASGNNDTETERKKEERKREREREREREREREREEERIRRFEIESESESERLLLVRAEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.12
5 0.12
6 0.11
7 0.12
8 0.13
9 0.11
10 0.11
11 0.11
12 0.1
13 0.1
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.08
21 0.07
22 0.06
23 0.07
24 0.08
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.03
33 0.03
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.05
40 0.06
41 0.14
42 0.18
43 0.21
44 0.22
45 0.25
46 0.3
47 0.37
48 0.44
49 0.46
50 0.49
51 0.5
52 0.5
53 0.51
54 0.48
55 0.42
56 0.37
57 0.32
58 0.29
59 0.33
60 0.4
61 0.48
62 0.56
63 0.63
64 0.72
65 0.8
66 0.86
67 0.89
68 0.91
69 0.91
70 0.9
71 0.9
72 0.85
73 0.85
74 0.81
75 0.8
76 0.74
77 0.73
78 0.67
79 0.66
80 0.69
81 0.67
82 0.67
83 0.64
84 0.61
85 0.54
86 0.52
87 0.46
88 0.43
89 0.38
90 0.35
91 0.33
92 0.34
93 0.31
94 0.3
95 0.26
96 0.2
97 0.16
98 0.14