Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2THZ6

Protein Details
Accession A0A2L2THZ6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
43-69ASVKSQGAYKKKPKRGIPKKLGAKRTGHydrophilic
202-237AKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAEBasic
246-269EMKAVKMISKKQAKKAAKKAGKKKBasic
NLS Segment(s)
PositionSequence
51-67YKKKPKRGIPKKLGAKR
206-269GLKTKRFRTRKQWFRHRRWRRERELEGQRKAEAKRAESGGEMKAVKMISKKQAKKAAKKAGKKK
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MRFLTIQRPILAAVAGLVRPAFTPAAPLGVQLANSLVQGQRFASVKSQGAYKKKPKRGIPKKLGAKRTGDQFVIPGNILYKQRGTHWWPGENCIMGRDHTIHSMATGYVKYYRDPARHPDRKYIGVVFDKNDTLPYPQHAERKRKLGMTVFTIKEAAAKPEISPSGIPFQVTRVEAGEPDRLLKLRKDYSYREDNWAIGKLAKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAEAKRAESGGEMKAVKMISKKQAKKAAKKAGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.08
6 0.09
7 0.11
8 0.11
9 0.08
10 0.11
11 0.11
12 0.15
13 0.15
14 0.15
15 0.15
16 0.15
17 0.15
18 0.12
19 0.13
20 0.1
21 0.1
22 0.11
23 0.1
24 0.09
25 0.1
26 0.11
27 0.13
28 0.14
29 0.15
30 0.18
31 0.21
32 0.22
33 0.23
34 0.28
35 0.31
36 0.39
37 0.47
38 0.54
39 0.6
40 0.67
41 0.75
42 0.78
43 0.83
44 0.86
45 0.87
46 0.87
47 0.87
48 0.88
49 0.88
50 0.86
51 0.8
52 0.75
53 0.67
54 0.65
55 0.58
56 0.48
57 0.4
58 0.33
59 0.3
60 0.25
61 0.21
62 0.14
63 0.11
64 0.14
65 0.15
66 0.15
67 0.15
68 0.15
69 0.17
70 0.23
71 0.28
72 0.33
73 0.36
74 0.42
75 0.4
76 0.43
77 0.43
78 0.38
79 0.33
80 0.25
81 0.21
82 0.15
83 0.16
84 0.14
85 0.13
86 0.13
87 0.14
88 0.12
89 0.11
90 0.11
91 0.1
92 0.09
93 0.08
94 0.08
95 0.11
96 0.12
97 0.12
98 0.17
99 0.21
100 0.23
101 0.26
102 0.34
103 0.41
104 0.48
105 0.5
106 0.53
107 0.52
108 0.52
109 0.51
110 0.44
111 0.37
112 0.33
113 0.32
114 0.25
115 0.22
116 0.2
117 0.18
118 0.17
119 0.13
120 0.11
121 0.1
122 0.11
123 0.14
124 0.17
125 0.24
126 0.31
127 0.38
128 0.4
129 0.46
130 0.47
131 0.44
132 0.44
133 0.41
134 0.37
135 0.34
136 0.37
137 0.31
138 0.29
139 0.27
140 0.25
141 0.23
142 0.21
143 0.17
144 0.12
145 0.12
146 0.11
147 0.14
148 0.15
149 0.13
150 0.13
151 0.12
152 0.14
153 0.14
154 0.15
155 0.11
156 0.13
157 0.15
158 0.15
159 0.14
160 0.12
161 0.12
162 0.12
163 0.15
164 0.16
165 0.12
166 0.13
167 0.14
168 0.14
169 0.16
170 0.18
171 0.23
172 0.26
173 0.3
174 0.35
175 0.39
176 0.44
177 0.51
178 0.51
179 0.5
180 0.46
181 0.42
182 0.39
183 0.36
184 0.3
185 0.24
186 0.22
187 0.17
188 0.16
189 0.19
190 0.18
191 0.19
192 0.27
193 0.33
194 0.4
195 0.46
196 0.55
197 0.61
198 0.69
199 0.75
200 0.76
201 0.79
202 0.82
203 0.86
204 0.88
205 0.88
206 0.91
207 0.94
208 0.94
209 0.94
210 0.95
211 0.95
212 0.94
213 0.94
214 0.9
215 0.89
216 0.89
217 0.87
218 0.83
219 0.75
220 0.67
221 0.63
222 0.57
223 0.54
224 0.48
225 0.41
226 0.4
227 0.4
228 0.38
229 0.35
230 0.37
231 0.31
232 0.31
233 0.28
234 0.22
235 0.22
236 0.21
237 0.22
238 0.24
239 0.29
240 0.34
241 0.44
242 0.51
243 0.57
244 0.68
245 0.75
246 0.8
247 0.84
248 0.86
249 0.85