Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TBU4

Protein Details
Accession A0A2L2TBU4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
249-274NLKDERRKWVWRLRLRQKEKLKGFQPHydrophilic
NLS Segment(s)
PositionSequence
262-266RLRQK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MATTNSHSSPLSDVVRELDLNAPPPAPLDLLSTVSSLFARRQEKLHKERLTLQDAEEEAKFVAARAATRKRLQEEEEEEAEMLDRLERALVPTPRIKDTEPSKEEIEALVNKELAKEEQGPGLRRAKHETAEEYEKRMVALEYRVDCLDIIEKERKQKEPVHYVDGLPTNVVIIDRHFRPIPETPAGNFSCLQCEVLDRRCGRTSDNARICEACERLGRRCLVKHLWTQESKLMESWKFAKSQRYGYDNLKDERRKWVWRLRLRQKEKLKGFQPMPAWPEKKGSDVKTGQQNTPKRWQDYLRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.21
5 0.2
6 0.19
7 0.21
8 0.21
9 0.19
10 0.17
11 0.18
12 0.18
13 0.14
14 0.13
15 0.14
16 0.14
17 0.17
18 0.17
19 0.17
20 0.15
21 0.16
22 0.15
23 0.13
24 0.14
25 0.19
26 0.22
27 0.24
28 0.31
29 0.4
30 0.5
31 0.57
32 0.64
33 0.62
34 0.62
35 0.69
36 0.7
37 0.66
38 0.57
39 0.49
40 0.44
41 0.39
42 0.37
43 0.28
44 0.22
45 0.16
46 0.15
47 0.14
48 0.09
49 0.1
50 0.09
51 0.11
52 0.18
53 0.25
54 0.3
55 0.35
56 0.4
57 0.43
58 0.47
59 0.47
60 0.47
61 0.46
62 0.46
63 0.43
64 0.38
65 0.34
66 0.29
67 0.26
68 0.18
69 0.12
70 0.07
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.14
77 0.16
78 0.19
79 0.24
80 0.26
81 0.28
82 0.31
83 0.29
84 0.3
85 0.35
86 0.42
87 0.39
88 0.4
89 0.39
90 0.37
91 0.36
92 0.29
93 0.26
94 0.18
95 0.17
96 0.15
97 0.15
98 0.14
99 0.14
100 0.14
101 0.11
102 0.12
103 0.12
104 0.12
105 0.15
106 0.18
107 0.2
108 0.24
109 0.3
110 0.3
111 0.29
112 0.35
113 0.33
114 0.33
115 0.33
116 0.32
117 0.31
118 0.36
119 0.35
120 0.32
121 0.31
122 0.28
123 0.25
124 0.22
125 0.18
126 0.11
127 0.12
128 0.12
129 0.12
130 0.14
131 0.14
132 0.13
133 0.13
134 0.12
135 0.12
136 0.09
137 0.11
138 0.15
139 0.17
140 0.24
141 0.27
142 0.29
143 0.31
144 0.37
145 0.4
146 0.44
147 0.46
148 0.44
149 0.42
150 0.4
151 0.39
152 0.34
153 0.27
154 0.18
155 0.15
156 0.1
157 0.09
158 0.09
159 0.06
160 0.05
161 0.09
162 0.09
163 0.12
164 0.13
165 0.13
166 0.17
167 0.2
168 0.24
169 0.23
170 0.24
171 0.22
172 0.29
173 0.29
174 0.27
175 0.24
176 0.19
177 0.18
178 0.18
179 0.17
180 0.11
181 0.13
182 0.15
183 0.19
184 0.25
185 0.24
186 0.28
187 0.3
188 0.31
189 0.3
190 0.37
191 0.4
192 0.44
193 0.49
194 0.47
195 0.45
196 0.45
197 0.43
198 0.38
199 0.32
200 0.24
201 0.23
202 0.24
203 0.27
204 0.32
205 0.33
206 0.32
207 0.33
208 0.37
209 0.38
210 0.41
211 0.44
212 0.46
213 0.5
214 0.49
215 0.49
216 0.47
217 0.43
218 0.38
219 0.34
220 0.32
221 0.25
222 0.27
223 0.28
224 0.26
225 0.27
226 0.29
227 0.35
228 0.35
229 0.42
230 0.45
231 0.46
232 0.48
233 0.5
234 0.56
235 0.54
236 0.54
237 0.55
238 0.54
239 0.51
240 0.57
241 0.57
242 0.56
243 0.58
244 0.63
245 0.64
246 0.69
247 0.78
248 0.79
249 0.84
250 0.85
251 0.87
252 0.88
253 0.88
254 0.86
255 0.85
256 0.79
257 0.77
258 0.71
259 0.67
260 0.61
261 0.56
262 0.53
263 0.53
264 0.5
265 0.42
266 0.47
267 0.42
268 0.45
269 0.47
270 0.45
271 0.46
272 0.48
273 0.53
274 0.57
275 0.6
276 0.6
277 0.61
278 0.65
279 0.63
280 0.69
281 0.7
282 0.64
283 0.66
284 0.67