Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2SQ58

Protein Details
Accession A0A2L2SQ58    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-61GGSRRSRDVRCAKRRTGKKGLEBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MNIQASLKKFKKEDFSTGPGEVDERGARLWGMGHETGGEGGSRRSRDVRCAKRRTGKKGLEDSPGTEHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.52
4 0.51
5 0.46
6 0.36
7 0.31
8 0.23
9 0.18
10 0.13
11 0.09
12 0.09
13 0.08
14 0.08
15 0.07
16 0.08
17 0.06
18 0.09
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.04
27 0.06
28 0.09
29 0.1
30 0.12
31 0.17
32 0.18
33 0.28
34 0.38
35 0.48
36 0.55
37 0.62
38 0.69
39 0.74
40 0.82
41 0.82
42 0.82
43 0.79
44 0.78
45 0.8
46 0.75
47 0.73
48 0.66
49 0.6