Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TUJ2

Protein Details
Accession A0A2L2TUJ2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-84QLDDPKEHNRKPKRTRQRVSVAANMQRARNCHNNIEKKYRERKSHydrophilic
NLS Segment(s)
PositionSequence
51-54KPKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEASVVTPRGLATALCSGHLTQRYRGVDTKRVGSLIPPYSQLDDPKEHNRKPKRTRQRVSVAANMQRARNCHNNIEKKYRERKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.16
5 0.2
6 0.27
7 0.26
8 0.23
9 0.31
10 0.32
11 0.35
12 0.4
13 0.39
14 0.41
15 0.41
16 0.42
17 0.35
18 0.33
19 0.3
20 0.26
21 0.27
22 0.22
23 0.2
24 0.18
25 0.18
26 0.2
27 0.21
28 0.21
29 0.18
30 0.18
31 0.21
32 0.29
33 0.35
34 0.36
35 0.45
36 0.53
37 0.61
38 0.68
39 0.75
40 0.76
41 0.8
42 0.84
43 0.84
44 0.84
45 0.82
46 0.79
47 0.76
48 0.71
49 0.65
50 0.65
51 0.57
52 0.51
53 0.45
54 0.42
55 0.4
56 0.42
57 0.41
58 0.43
59 0.52
60 0.58
61 0.64
62 0.71
63 0.74
64 0.75