Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TCF6

Protein Details
Accession A0A2L2TCF6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKVPWRLSKFQKRRHRLRLRAVDDVHydrophilic
77-103KYTMFDRKAKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKRYRKGIHKLPK
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRITNPLSGGLLWKVPWRLSKFQKRRHRLRLRAVDDVVATVDAALAKKGQTLEALDRWKAEMPTEAEMLPKDKYTMFDRKAKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.6
26 0.49
27 0.4
28 0.29
29 0.18
30 0.12
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.1
44 0.15
45 0.17
46 0.16
47 0.16
48 0.17
49 0.18
50 0.16
51 0.14
52 0.14
53 0.14
54 0.16
55 0.17
56 0.16
57 0.15
58 0.15
59 0.16
60 0.13
61 0.11
62 0.1
63 0.1
64 0.13
65 0.18
66 0.27
67 0.3
68 0.38
69 0.44
70 0.54
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79