Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LNR4

Protein Details
Accession E2LNR4   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-82VTPVRLQRRRHLRSLKRRKFEBasic
NLS Segment(s)
PositionSequence
38-86RREVKSAKKENAKPYTKAPKIQRLVTPVRLQRRRHLRSLKRRKFEAQKE
97-105KRIAEKKAK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mpr:MPER_08477  -  
Amino Acid Sequences MVLPIQSCQRELGPKRATKIRRFFNLSKEDDVRKYVVRREVKSAKKENAKPYTKAPKIQRLVTPVRLQRRRHLRSLKRRKFEAQKEQKAEYDALLAKRIAEKKAKVAAVKAAHHQKATTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.6
4 0.65
5 0.65
6 0.7
7 0.68
8 0.68
9 0.73
10 0.71
11 0.71
12 0.72
13 0.66
14 0.62
15 0.58
16 0.54
17 0.47
18 0.46
19 0.39
20 0.35
21 0.34
22 0.33
23 0.38
24 0.41
25 0.41
26 0.47
27 0.54
28 0.57
29 0.63
30 0.65
31 0.63
32 0.65
33 0.69
34 0.7
35 0.71
36 0.67
37 0.61
38 0.62
39 0.65
40 0.59
41 0.6
42 0.56
43 0.56
44 0.55
45 0.56
46 0.5
47 0.46
48 0.47
49 0.45
50 0.45
51 0.4
52 0.47
53 0.51
54 0.5
55 0.52
56 0.59
57 0.59
58 0.62
59 0.68
60 0.68
61 0.72
62 0.82
63 0.83
64 0.79
65 0.79
66 0.79
67 0.78
68 0.78
69 0.78
70 0.77
71 0.78
72 0.76
73 0.74
74 0.67
75 0.59
76 0.5
77 0.39
78 0.32
79 0.26
80 0.22
81 0.22
82 0.2
83 0.18
84 0.24
85 0.27
86 0.27
87 0.31
88 0.32
89 0.37
90 0.44
91 0.47
92 0.43
93 0.43
94 0.46
95 0.45
96 0.45
97 0.47
98 0.49
99 0.49
100 0.48