Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TGD2

Protein Details
Accession A0A2L2TGD2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35DGIRRACEPCRRKKSRCTGERPICSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTPGSRSQTDGIRRACEPCRRKKSRCTGERPICSFCERLDLPCEYAARGSSTTNRATRATRHQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.51
5 0.55
6 0.62
7 0.68
8 0.72
9 0.77
10 0.82
11 0.82
12 0.83
13 0.81
14 0.81
15 0.82
16 0.83
17 0.77
18 0.68
19 0.59
20 0.52
21 0.44
22 0.33
23 0.29
24 0.22
25 0.2
26 0.21
27 0.21
28 0.2
29 0.22
30 0.22
31 0.16
32 0.17
33 0.16
34 0.15
35 0.14
36 0.15
37 0.17
38 0.21
39 0.27
40 0.29
41 0.31
42 0.32
43 0.35
44 0.39