Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2SW39

Protein Details
Accession A0A2L2SW39    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
112-132EKEAKQFKKKMDEREKNASRABasic
NLS Segment(s)
PositionSequence
271-331RAPPPPPPPPSAGRSQDGPPAPPAPRKGGPPPPPAPRRSGKAETAPERAPSPPRPKFGVPP
462-508PPPPPPPPGGPAAPPPPPPPLPPSGGAPPPPPPPPPPGGHGAPPPPP
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR033927  WASPfam_EVH1  
IPR000697  WH1/EVH1_dom  
IPR003124  WH2_dom  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0003779  F:actin binding  
Pfam View protein in Pfam  
PF00568  WH1  
PROSITE View protein in PROSITE  
PS50229  WH1  
PS51082  WH2  
CDD cd01205  EVH1_WASP-like  
Amino Acid Sequences MPSILNDDDKDAVKRFIPKQSNKIQAVAVARLYVAYPNRSKWTYTGIQGAVALVNDLVGNTYWIKMVDISPTNRGVIWDQEIFDTWNYNQDRTFFHTFELEECLAGLSFVDEKEAKQFKKKMDEREKNASRATKATPFGGGAQPSHKHGLLGGLFSHRHSTHHPTGPTPPESPRMPANSIQHHVINSTPNLNGHRHSEFSLLDAFDPLWREHFGADLQDKGLTDDFIKENQEFIVDFLREEQQKASQPHSTPPPPPAPASPANGNDGRNSRAPPPPPPPPSAGRSQDGPPAPPAPRKGGPPPPPAPRRSGKAETAPERAPSPPRPKFGVPPPLADAGKFAHSEPPRAVPAAPNPGPPPPPRPAKTPMDSTKNESHRFGVPPPFPGSRVPPPTPSRGSVPPPPPPRSEPPAALPPPLPPKVPTSSAPPLPPPSTRPVPPPPAASSHPPVPPPLPPITNGAPPPPPPPPPPGGPAAPPPPPPPLPPSGGAPPPPPPPPPPGGHGAPPPPPPMPPGGGAPAPSAAGDPSRSAVLAGIQQAGGIHSLKKVDRSQIRDRSGAQVGGSDVGGNSATASAVSASGGGGGMADALAAALQKRKEKVSKSDDESDNDDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.45
4 0.53
5 0.58
6 0.65
7 0.72
8 0.78
9 0.72
10 0.69
11 0.6
12 0.55
13 0.51
14 0.44
15 0.35
16 0.25
17 0.22
18 0.2
19 0.19
20 0.19
21 0.19
22 0.23
23 0.26
24 0.3
25 0.37
26 0.38
27 0.4
28 0.37
29 0.41
30 0.39
31 0.39
32 0.42
33 0.36
34 0.35
35 0.33
36 0.31
37 0.24
38 0.18
39 0.15
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.07
47 0.07
48 0.08
49 0.09
50 0.1
51 0.1
52 0.11
53 0.12
54 0.17
55 0.23
56 0.25
57 0.28
58 0.3
59 0.3
60 0.28
61 0.29
62 0.24
63 0.22
64 0.24
65 0.22
66 0.21
67 0.21
68 0.22
69 0.22
70 0.2
71 0.19
72 0.15
73 0.21
74 0.22
75 0.23
76 0.23
77 0.24
78 0.27
79 0.31
80 0.37
81 0.29
82 0.28
83 0.3
84 0.29
85 0.28
86 0.3
87 0.23
88 0.17
89 0.17
90 0.16
91 0.13
92 0.12
93 0.1
94 0.06
95 0.06
96 0.06
97 0.09
98 0.09
99 0.1
100 0.19
101 0.27
102 0.28
103 0.36
104 0.42
105 0.45
106 0.56
107 0.62
108 0.64
109 0.68
110 0.77
111 0.75
112 0.81
113 0.8
114 0.74
115 0.73
116 0.67
117 0.58
118 0.52
119 0.49
120 0.44
121 0.4
122 0.37
123 0.32
124 0.29
125 0.29
126 0.28
127 0.25
128 0.2
129 0.23
130 0.23
131 0.25
132 0.27
133 0.24
134 0.21
135 0.2
136 0.24
137 0.2
138 0.19
139 0.17
140 0.17
141 0.18
142 0.18
143 0.23
144 0.17
145 0.19
146 0.22
147 0.3
148 0.35
149 0.41
150 0.42
151 0.4
152 0.47
153 0.5
154 0.49
155 0.43
156 0.38
157 0.36
158 0.36
159 0.36
160 0.34
161 0.33
162 0.32
163 0.35
164 0.38
165 0.39
166 0.4
167 0.4
168 0.36
169 0.31
170 0.29
171 0.25
172 0.22
173 0.18
174 0.17
175 0.16
176 0.17
177 0.19
178 0.21
179 0.21
180 0.22
181 0.23
182 0.22
183 0.23
184 0.23
185 0.2
186 0.2
187 0.21
188 0.16
189 0.14
190 0.13
191 0.12
192 0.11
193 0.13
194 0.11
195 0.1
196 0.11
197 0.11
198 0.11
199 0.12
200 0.11
201 0.13
202 0.14
203 0.13
204 0.12
205 0.13
206 0.13
207 0.13
208 0.13
209 0.09
210 0.09
211 0.11
212 0.11
213 0.12
214 0.14
215 0.13
216 0.13
217 0.13
218 0.13
219 0.1
220 0.1
221 0.12
222 0.1
223 0.1
224 0.11
225 0.15
226 0.15
227 0.16
228 0.16
229 0.16
230 0.22
231 0.25
232 0.26
233 0.27
234 0.28
235 0.31
236 0.38
237 0.37
238 0.33
239 0.35
240 0.37
241 0.33
242 0.34
243 0.31
244 0.29
245 0.28
246 0.3
247 0.29
248 0.25
249 0.27
250 0.28
251 0.27
252 0.25
253 0.24
254 0.23
255 0.21
256 0.22
257 0.22
258 0.25
259 0.27
260 0.3
261 0.34
262 0.4
263 0.42
264 0.43
265 0.43
266 0.41
267 0.42
268 0.43
269 0.41
270 0.33
271 0.32
272 0.31
273 0.32
274 0.29
275 0.27
276 0.22
277 0.22
278 0.22
279 0.23
280 0.24
281 0.23
282 0.25
283 0.27
284 0.32
285 0.37
286 0.43
287 0.47
288 0.51
289 0.54
290 0.58
291 0.57
292 0.56
293 0.5
294 0.47
295 0.47
296 0.45
297 0.4
298 0.41
299 0.45
300 0.43
301 0.44
302 0.41
303 0.34
304 0.31
305 0.3
306 0.28
307 0.29
308 0.35
309 0.36
310 0.38
311 0.42
312 0.42
313 0.46
314 0.49
315 0.52
316 0.43
317 0.4
318 0.4
319 0.39
320 0.37
321 0.32
322 0.25
323 0.16
324 0.17
325 0.15
326 0.13
327 0.16
328 0.17
329 0.19
330 0.19
331 0.21
332 0.2
333 0.2
334 0.2
335 0.15
336 0.19
337 0.25
338 0.25
339 0.24
340 0.24
341 0.26
342 0.29
343 0.29
344 0.29
345 0.27
346 0.35
347 0.35
348 0.39
349 0.43
350 0.47
351 0.48
352 0.52
353 0.52
354 0.51
355 0.51
356 0.51
357 0.53
358 0.54
359 0.52
360 0.45
361 0.41
362 0.37
363 0.38
364 0.36
365 0.36
366 0.3
367 0.31
368 0.34
369 0.32
370 0.3
371 0.3
372 0.32
373 0.31
374 0.37
375 0.36
376 0.39
377 0.41
378 0.46
379 0.47
380 0.43
381 0.4
382 0.38
383 0.41
384 0.42
385 0.43
386 0.46
387 0.51
388 0.53
389 0.52
390 0.53
391 0.54
392 0.52
393 0.51
394 0.44
395 0.41
396 0.46
397 0.44
398 0.4
399 0.34
400 0.32
401 0.36
402 0.35
403 0.31
404 0.24
405 0.28
406 0.3
407 0.32
408 0.29
409 0.3
410 0.34
411 0.37
412 0.37
413 0.35
414 0.36
415 0.36
416 0.36
417 0.32
418 0.33
419 0.35
420 0.35
421 0.39
422 0.42
423 0.46
424 0.47
425 0.48
426 0.43
427 0.43
428 0.44
429 0.42
430 0.39
431 0.37
432 0.37
433 0.34
434 0.34
435 0.31
436 0.3
437 0.3
438 0.3
439 0.25
440 0.24
441 0.29
442 0.29
443 0.32
444 0.3
445 0.29
446 0.28
447 0.28
448 0.31
449 0.3
450 0.32
451 0.3
452 0.35
453 0.36
454 0.36
455 0.37
456 0.38
457 0.35
458 0.33
459 0.36
460 0.36
461 0.35
462 0.35
463 0.34
464 0.36
465 0.36
466 0.36
467 0.35
468 0.34
469 0.34
470 0.33
471 0.34
472 0.34
473 0.35
474 0.35
475 0.33
476 0.33
477 0.34
478 0.36
479 0.35
480 0.33
481 0.34
482 0.37
483 0.38
484 0.37
485 0.38
486 0.38
487 0.38
488 0.4
489 0.4
490 0.4
491 0.4
492 0.4
493 0.35
494 0.33
495 0.31
496 0.29
497 0.27
498 0.24
499 0.23
500 0.23
501 0.24
502 0.24
503 0.23
504 0.19
505 0.17
506 0.15
507 0.13
508 0.1
509 0.11
510 0.11
511 0.11
512 0.11
513 0.12
514 0.11
515 0.11
516 0.11
517 0.11
518 0.13
519 0.13
520 0.13
521 0.12
522 0.12
523 0.12
524 0.12
525 0.12
526 0.1
527 0.1
528 0.1
529 0.15
530 0.16
531 0.23
532 0.26
533 0.34
534 0.41
535 0.48
536 0.57
537 0.62
538 0.66
539 0.64
540 0.62
541 0.59
542 0.55
543 0.49
544 0.38
545 0.3
546 0.26
547 0.23
548 0.21
549 0.15
550 0.1
551 0.1
552 0.09
553 0.07
554 0.07
555 0.06
556 0.06
557 0.05
558 0.06
559 0.05
560 0.05
561 0.06
562 0.05
563 0.05
564 0.05
565 0.05
566 0.05
567 0.04
568 0.04
569 0.04
570 0.03
571 0.03
572 0.03
573 0.03
574 0.03
575 0.04
576 0.05
577 0.1
578 0.15
579 0.21
580 0.25
581 0.33
582 0.41
583 0.48
584 0.57
585 0.62
586 0.68
587 0.7
588 0.76
589 0.73
590 0.69