Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TIG6

Protein Details
Accession A0A2L2TIG6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-136AGSAKKPRTPRAKAKKESDDDEEPKPKPKASATKRKVKKEEEEPKEBasic
NLS Segment(s)
PositionSequence
82-130SKRKAKGETAGSAKKPRTPRAKAKKESDDDEEPKPKPKASATKRKVKKE
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSKQEPIDQVKFLVSCIGHTSNGRPDFQAVADELDIVTKAAAQKRYERMLKAHGISRPGALAIANNGDGKNDTPPATPTTPSKRKAKGETAGSAKKPRTPRAKAKKESDDDEEPKPKPKASATKRKVKKEEEEPKEEPDEAAAESTNSLSDAPTSDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.2
4 0.22
5 0.2
6 0.22
7 0.25
8 0.3
9 0.33
10 0.33
11 0.28
12 0.28
13 0.27
14 0.26
15 0.24
16 0.16
17 0.15
18 0.13
19 0.13
20 0.11
21 0.09
22 0.09
23 0.07
24 0.06
25 0.05
26 0.09
27 0.13
28 0.18
29 0.2
30 0.27
31 0.32
32 0.39
33 0.42
34 0.41
35 0.4
36 0.41
37 0.44
38 0.4
39 0.39
40 0.34
41 0.32
42 0.31
43 0.28
44 0.22
45 0.17
46 0.14
47 0.1
48 0.08
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.15
63 0.16
64 0.17
65 0.19
66 0.27
67 0.33
68 0.37
69 0.43
70 0.45
71 0.5
72 0.54
73 0.57
74 0.54
75 0.51
76 0.52
77 0.52
78 0.5
79 0.48
80 0.47
81 0.41
82 0.41
83 0.42
84 0.45
85 0.48
86 0.51
87 0.59
88 0.65
89 0.75
90 0.77
91 0.81
92 0.82
93 0.77
94 0.73
95 0.69
96 0.66
97 0.58
98 0.57
99 0.55
100 0.46
101 0.49
102 0.46
103 0.4
104 0.36
105 0.4
106 0.44
107 0.48
108 0.58
109 0.59
110 0.67
111 0.75
112 0.82
113 0.83
114 0.8
115 0.79
116 0.79
117 0.82
118 0.79
119 0.79
120 0.71
121 0.68
122 0.63
123 0.55
124 0.43
125 0.34
126 0.27
127 0.19
128 0.17
129 0.13
130 0.1
131 0.1
132 0.1
133 0.09
134 0.08
135 0.07
136 0.07
137 0.07
138 0.09