Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2T3V6

Protein Details
Accession A0A2L2T3V6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-33EKDLRWHRPSHKSAKDWFNKWKPBasic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MLEAFFVPSDEKDLRWHRPSHKSAKDWFNKWKPSGDSVKIIPEEVALDVDRNVRHRVDRPAKLSLPVGKARGGNARGSSHSGTKVDARYHNHTSRDVDDEMTAFDAKHVDDLEAMNQMASLYDKPRGVKMPSLASRSSKASGTGMPSSSDPALIAHGSFRSEDSNDSSTSLADSSSDVVAPSTLIGIPDDDDSYVEPPPGPEARSLVKLEPRSIMNLELIPSRDLEPSLNQSSDAYYSGAEDEDQDQPPRKKSALMEEPKFEEFEYYPGELNLFQKDIASVLSEHSTIHIDASGRDETNETGSFLRPPYRSGKVTLRNLATVLDKVENLLHCCQSIRVTVEKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.53
4 0.56
5 0.65
6 0.74
7 0.76
8 0.78
9 0.76
10 0.79
11 0.82
12 0.82
13 0.79
14 0.81
15 0.8
16 0.79
17 0.75
18 0.73
19 0.67
20 0.65
21 0.67
22 0.6
23 0.56
24 0.49
25 0.53
26 0.46
27 0.43
28 0.35
29 0.26
30 0.22
31 0.17
32 0.17
33 0.1
34 0.1
35 0.11
36 0.15
37 0.16
38 0.18
39 0.21
40 0.21
41 0.26
42 0.31
43 0.41
44 0.47
45 0.53
46 0.54
47 0.59
48 0.58
49 0.56
50 0.55
51 0.5
52 0.46
53 0.42
54 0.4
55 0.35
56 0.34
57 0.34
58 0.38
59 0.33
60 0.31
61 0.3
62 0.31
63 0.3
64 0.33
65 0.33
66 0.28
67 0.3
68 0.26
69 0.25
70 0.27
71 0.29
72 0.3
73 0.34
74 0.37
75 0.4
76 0.48
77 0.52
78 0.5
79 0.49
80 0.47
81 0.43
82 0.42
83 0.36
84 0.28
85 0.23
86 0.21
87 0.18
88 0.16
89 0.14
90 0.09
91 0.08
92 0.08
93 0.08
94 0.09
95 0.09
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.1
102 0.08
103 0.07
104 0.07
105 0.06
106 0.07
107 0.07
108 0.08
109 0.11
110 0.13
111 0.14
112 0.17
113 0.2
114 0.21
115 0.24
116 0.25
117 0.3
118 0.33
119 0.36
120 0.35
121 0.33
122 0.34
123 0.33
124 0.31
125 0.23
126 0.2
127 0.17
128 0.17
129 0.19
130 0.18
131 0.16
132 0.16
133 0.15
134 0.16
135 0.14
136 0.13
137 0.09
138 0.07
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.09
150 0.12
151 0.14
152 0.13
153 0.14
154 0.13
155 0.12
156 0.12
157 0.11
158 0.07
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.06
177 0.05
178 0.05
179 0.06
180 0.07
181 0.07
182 0.07
183 0.06
184 0.06
185 0.09
186 0.1
187 0.1
188 0.1
189 0.12
190 0.14
191 0.17
192 0.19
193 0.18
194 0.22
195 0.23
196 0.24
197 0.24
198 0.23
199 0.22
200 0.21
201 0.2
202 0.16
203 0.15
204 0.14
205 0.14
206 0.14
207 0.12
208 0.12
209 0.13
210 0.12
211 0.12
212 0.12
213 0.13
214 0.17
215 0.19
216 0.19
217 0.17
218 0.17
219 0.17
220 0.17
221 0.16
222 0.11
223 0.08
224 0.08
225 0.09
226 0.08
227 0.07
228 0.07
229 0.09
230 0.12
231 0.14
232 0.16
233 0.23
234 0.26
235 0.3
236 0.32
237 0.31
238 0.31
239 0.33
240 0.4
241 0.44
242 0.49
243 0.49
244 0.49
245 0.52
246 0.49
247 0.46
248 0.36
249 0.28
250 0.2
251 0.19
252 0.19
253 0.16
254 0.16
255 0.15
256 0.16
257 0.15
258 0.16
259 0.16
260 0.13
261 0.12
262 0.11
263 0.12
264 0.11
265 0.1
266 0.1
267 0.08
268 0.09
269 0.11
270 0.11
271 0.11
272 0.11
273 0.13
274 0.11
275 0.11
276 0.12
277 0.11
278 0.11
279 0.16
280 0.17
281 0.16
282 0.16
283 0.17
284 0.16
285 0.2
286 0.2
287 0.17
288 0.16
289 0.17
290 0.19
291 0.2
292 0.26
293 0.22
294 0.25
295 0.3
296 0.36
297 0.37
298 0.41
299 0.49
300 0.51
301 0.59
302 0.63
303 0.59
304 0.54
305 0.52
306 0.48
307 0.4
308 0.32
309 0.27
310 0.21
311 0.18
312 0.18
313 0.21
314 0.22
315 0.24
316 0.27
317 0.25
318 0.24
319 0.25
320 0.26
321 0.24
322 0.26
323 0.26
324 0.29