Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TC59

Protein Details
Accession A0A2L2TC59    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
197-226EKDGEVKPPKPKKIKAKKELEKNKNKWQEFBasic
NLS Segment(s)
PositionSequence
199-238DGEVKPPKPKKIKAKKELEKNKNKWQEFSAKSKGGKSTKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSSVAEIEEEKKAYQEQFEIVLGQLRDDPDNVELKALKDELNSFIDLLNEQIAELKPAQAPKPAPKQPSPPPEPEKWSRENHPAFKKAAPAEEKEQAAPVNYQVNDTVLAKWVSGDKGFYTARITSITGSSTNPIYVVKFKTYDNTETLQARDIRPVSNKRKADGTPTTSTPATPSAPGLVTSAGATVYPDAKKDAEKDGEVKPPKPKKIKAKKELEKNKNKWQEFSAKSKGGKSTKKDSMFRTPEGVHGRVGFTGSGQAMRKDPTRSRHIYQVNEELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.21
5 0.22
6 0.21
7 0.18
8 0.21
9 0.18
10 0.17
11 0.17
12 0.16
13 0.17
14 0.16
15 0.18
16 0.16
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.22
23 0.21
24 0.19
25 0.17
26 0.19
27 0.2
28 0.21
29 0.2
30 0.17
31 0.17
32 0.16
33 0.15
34 0.13
35 0.11
36 0.08
37 0.07
38 0.1
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.18
45 0.19
46 0.22
47 0.26
48 0.32
49 0.42
50 0.46
51 0.5
52 0.52
53 0.59
54 0.62
55 0.69
56 0.66
57 0.65
58 0.65
59 0.64
60 0.66
61 0.65
62 0.62
63 0.58
64 0.57
65 0.54
66 0.57
67 0.6
68 0.61
69 0.62
70 0.6
71 0.56
72 0.53
73 0.53
74 0.45
75 0.44
76 0.38
77 0.35
78 0.35
79 0.37
80 0.36
81 0.3
82 0.29
83 0.23
84 0.21
85 0.17
86 0.15
87 0.15
88 0.14
89 0.15
90 0.14
91 0.14
92 0.14
93 0.14
94 0.13
95 0.1
96 0.1
97 0.1
98 0.1
99 0.11
100 0.1
101 0.1
102 0.1
103 0.08
104 0.12
105 0.12
106 0.12
107 0.13
108 0.12
109 0.13
110 0.14
111 0.14
112 0.1
113 0.11
114 0.11
115 0.1
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.1
124 0.11
125 0.12
126 0.13
127 0.13
128 0.17
129 0.2
130 0.21
131 0.2
132 0.2
133 0.21
134 0.21
135 0.22
136 0.21
137 0.21
138 0.19
139 0.2
140 0.19
141 0.19
142 0.24
143 0.33
144 0.37
145 0.44
146 0.45
147 0.42
148 0.47
149 0.45
150 0.47
151 0.44
152 0.42
153 0.37
154 0.37
155 0.39
156 0.34
157 0.33
158 0.27
159 0.22
160 0.17
161 0.14
162 0.13
163 0.11
164 0.12
165 0.12
166 0.11
167 0.09
168 0.08
169 0.08
170 0.07
171 0.06
172 0.05
173 0.05
174 0.05
175 0.08
176 0.08
177 0.09
178 0.11
179 0.12
180 0.14
181 0.16
182 0.21
183 0.21
184 0.23
185 0.26
186 0.28
187 0.36
188 0.38
189 0.4
190 0.44
191 0.49
192 0.56
193 0.62
194 0.67
195 0.69
196 0.77
197 0.84
198 0.84
199 0.87
200 0.87
201 0.89
202 0.92
203 0.91
204 0.91
205 0.88
206 0.88
207 0.87
208 0.8
209 0.72
210 0.66
211 0.66
212 0.6
213 0.61
214 0.58
215 0.54
216 0.55
217 0.56
218 0.58
219 0.57
220 0.6
221 0.58
222 0.6
223 0.63
224 0.69
225 0.7
226 0.68
227 0.7
228 0.68
229 0.64
230 0.6
231 0.52
232 0.51
233 0.52
234 0.47
235 0.38
236 0.33
237 0.31
238 0.26
239 0.26
240 0.19
241 0.13
242 0.15
243 0.13
244 0.17
245 0.17
246 0.19
247 0.21
248 0.25
249 0.29
250 0.33
251 0.4
252 0.43
253 0.51
254 0.55
255 0.57
256 0.64
257 0.67
258 0.66
259 0.66