Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TSD2

Protein Details
Accession A0A2L2TSD2    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-105APSPSAKKTPGRKRGPKPKTPKMVGBasic
111-135DDYGSPKKSTPRKRRAPKAEIDDEAHydrophilic
NLS Segment(s)
PositionSequence
85-102SAKKTPGRKRGPKPKTPK
117-128KKSTPRKRRAPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSDISTPKTNAWTDEAKASCPYISRSSNELLLRIIAQLKPEGKSINWNEITMEGRTMKSLQNQWTAFNKKIDALKQQAADAPSPSAKKTPGRKRGPKPKTPKMVGSDDDDDDYGSPKKSTPRKRRAPKAEIDDEASTKAIKMELNETIKAEDGEFDYEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.31
4 0.31
5 0.3
6 0.26
7 0.23
8 0.26
9 0.25
10 0.27
11 0.28
12 0.3
13 0.31
14 0.36
15 0.35
16 0.32
17 0.25
18 0.23
19 0.2
20 0.18
21 0.18
22 0.13
23 0.13
24 0.16
25 0.18
26 0.18
27 0.2
28 0.2
29 0.18
30 0.26
31 0.28
32 0.33
33 0.32
34 0.31
35 0.29
36 0.29
37 0.31
38 0.22
39 0.21
40 0.13
41 0.12
42 0.13
43 0.14
44 0.14
45 0.17
46 0.22
47 0.24
48 0.3
49 0.31
50 0.33
51 0.39
52 0.42
53 0.39
54 0.36
55 0.32
56 0.27
57 0.3
58 0.29
59 0.27
60 0.27
61 0.28
62 0.27
63 0.26
64 0.26
65 0.24
66 0.21
67 0.17
68 0.13
69 0.12
70 0.12
71 0.13
72 0.12
73 0.14
74 0.2
75 0.3
76 0.39
77 0.48
78 0.57
79 0.67
80 0.76
81 0.84
82 0.86
83 0.86
84 0.86
85 0.85
86 0.84
87 0.78
88 0.74
89 0.68
90 0.65
91 0.57
92 0.53
93 0.46
94 0.37
95 0.34
96 0.27
97 0.22
98 0.16
99 0.17
100 0.13
101 0.11
102 0.11
103 0.12
104 0.21
105 0.3
106 0.41
107 0.5
108 0.59
109 0.69
110 0.8
111 0.89
112 0.91
113 0.89
114 0.88
115 0.86
116 0.82
117 0.73
118 0.67
119 0.58
120 0.49
121 0.42
122 0.33
123 0.24
124 0.18
125 0.16
126 0.12
127 0.11
128 0.12
129 0.15
130 0.22
131 0.26
132 0.28
133 0.28
134 0.27
135 0.28
136 0.26
137 0.22
138 0.16
139 0.14