Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2SUS0

Protein Details
Accession A0A2L2SUS0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDSRIRRNDYLNRKQPRRINAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019587  Polyketide_cyclase/dehydratase  
IPR023393  START-like_dom_sf  
Pfam View protein in Pfam  
PF10604  Polyketide_cyc2  
CDD cd07821  PYR_PYL_RCAR_like  
Amino Acid Sequences MDSRIRRNDYLNRKQPRRINAEFDSLEVYLALAAVIAMSARVDESLSTTSKTHQEMIPLPKQETHPFNGLDLSSLYQPFAVLKMSKQPLTHYITVTREINAPIGEVWGLVAAFGGEKAWYPGCLKLSLEGFGIGSIRTFSYGYTAGKNKGKRYDFSEEMTAYDADNHSMTFRVRRPHFPDMIAFGTTVLDPIGPDKTCFRWIAEVSPVPEEYMGALKEDLDERFNGLITAIAQQVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.81
4 0.79
5 0.74
6 0.72
7 0.65
8 0.67
9 0.59
10 0.52
11 0.46
12 0.37
13 0.3
14 0.22
15 0.17
16 0.09
17 0.08
18 0.06
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.07
32 0.1
33 0.11
34 0.13
35 0.13
36 0.16
37 0.2
38 0.22
39 0.22
40 0.21
41 0.24
42 0.29
43 0.36
44 0.4
45 0.38
46 0.37
47 0.38
48 0.4
49 0.42
50 0.39
51 0.35
52 0.33
53 0.31
54 0.3
55 0.28
56 0.25
57 0.2
58 0.16
59 0.14
60 0.11
61 0.11
62 0.1
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.08
70 0.16
71 0.19
72 0.21
73 0.21
74 0.23
75 0.27
76 0.33
77 0.34
78 0.27
79 0.28
80 0.28
81 0.31
82 0.29
83 0.23
84 0.19
85 0.18
86 0.17
87 0.13
88 0.12
89 0.08
90 0.08
91 0.07
92 0.05
93 0.05
94 0.04
95 0.03
96 0.03
97 0.03
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.04
105 0.04
106 0.05
107 0.06
108 0.08
109 0.1
110 0.11
111 0.11
112 0.12
113 0.13
114 0.12
115 0.12
116 0.1
117 0.08
118 0.08
119 0.08
120 0.06
121 0.05
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.07
128 0.09
129 0.1
130 0.14
131 0.17
132 0.21
133 0.26
134 0.3
135 0.32
136 0.39
137 0.41
138 0.4
139 0.44
140 0.47
141 0.45
142 0.44
143 0.43
144 0.35
145 0.32
146 0.31
147 0.25
148 0.17
149 0.16
150 0.13
151 0.1
152 0.1
153 0.09
154 0.08
155 0.09
156 0.1
157 0.14
158 0.18
159 0.26
160 0.3
161 0.38
162 0.46
163 0.52
164 0.54
165 0.5
166 0.49
167 0.44
168 0.43
169 0.35
170 0.27
171 0.19
172 0.17
173 0.15
174 0.12
175 0.08
176 0.05
177 0.05
178 0.07
179 0.11
180 0.1
181 0.12
182 0.15
183 0.19
184 0.23
185 0.24
186 0.25
187 0.27
188 0.28
189 0.31
190 0.35
191 0.35
192 0.33
193 0.35
194 0.33
195 0.26
196 0.25
197 0.21
198 0.15
199 0.15
200 0.13
201 0.12
202 0.12
203 0.11
204 0.13
205 0.15
206 0.16
207 0.14
208 0.14
209 0.15
210 0.16
211 0.16
212 0.14
213 0.12
214 0.12
215 0.11
216 0.13