Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TGG2

Protein Details
Accession A0A2L2TGG2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-46IVHSKRQASKVHKPKQTKKNVDKVHRKFTSHydrophilic
63-92LELLGQKKKKEENKKKDKRTTTKGGSKKFGBasic
NLS Segment(s)
PositionSequence
20-36SKRQASKVHKPKQTKKN
68-92QKKKKEENKKKDKRTTTKGGSKKFG
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGTVKNLGRVAPAKIVHSKRQASKVHKPKQTKKNVDKVHRKFTSGMTAQTEKLLSERAGHLELLGQKKKKEENKKKDKRTTTKGGSKKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.36
4 0.4
5 0.42
6 0.48
7 0.52
8 0.51
9 0.59
10 0.63
11 0.63
12 0.69
13 0.73
14 0.74
15 0.75
16 0.79
17 0.81
18 0.83
19 0.86
20 0.86
21 0.84
22 0.84
23 0.85
24 0.86
25 0.86
26 0.82
27 0.82
28 0.72
29 0.66
30 0.57
31 0.5
32 0.47
33 0.38
34 0.33
35 0.26
36 0.26
37 0.24
38 0.24
39 0.22
40 0.14
41 0.13
42 0.13
43 0.09
44 0.1
45 0.1
46 0.12
47 0.13
48 0.13
49 0.12
50 0.13
51 0.18
52 0.23
53 0.28
54 0.29
55 0.3
56 0.35
57 0.43
58 0.5
59 0.57
60 0.61
61 0.66
62 0.75
63 0.85
64 0.91
65 0.93
66 0.94
67 0.93
68 0.91
69 0.9
70 0.89
71 0.88
72 0.87