Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TRY7

Protein Details
Accession A0A2L2TRY7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
308-336PVATKAPSSKCKAKRAAKKAAKAKRALKKHydrophilic
NLS Segment(s)
PositionSequence
317-336KCKAKRAAKKAAKAKRALKK
Subcellular Location(s) cyto 10extr 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MRTSFSTVLALAAALPTAFAHYNFEALIVNGEVSEPYQYVRKTTNNNSPVTDVTSKDIVCNAGGLDKDIRAATKTMQVSPGDEVGFTVASEMGHPGPLSVYLSKAPDGTEASDYLGDGDWFKVYEMTWKKIGAEGVEWANYMNGQSGGIQNFTFTLPKDTPKGTYLMRAEHVGLHGAGEKNGAQFYIGCAQITVDGTGAGKPSPMVKLPGAFKATDPSLLLSIYYPPVTKYDAPGPRTWPNACTDHTPNFAGQASDGDCTGEKAGSGSDSGSAAPVASDAPATDAPATSAPVATPTAAAVTTEAPAAPVATKAPSSKCKAKRAAKKAAKAKRALKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.07
5 0.08
6 0.08
7 0.13
8 0.14
9 0.15
10 0.14
11 0.15
12 0.13
13 0.12
14 0.14
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.09
22 0.07
23 0.08
24 0.13
25 0.14
26 0.17
27 0.22
28 0.28
29 0.35
30 0.44
31 0.53
32 0.54
33 0.56
34 0.55
35 0.52
36 0.47
37 0.45
38 0.4
39 0.3
40 0.28
41 0.29
42 0.27
43 0.25
44 0.25
45 0.19
46 0.17
47 0.16
48 0.12
49 0.11
50 0.11
51 0.13
52 0.13
53 0.12
54 0.13
55 0.13
56 0.14
57 0.12
58 0.14
59 0.13
60 0.19
61 0.21
62 0.21
63 0.25
64 0.24
65 0.25
66 0.25
67 0.26
68 0.19
69 0.16
70 0.15
71 0.12
72 0.11
73 0.09
74 0.08
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.09
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.13
92 0.12
93 0.12
94 0.13
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.11
101 0.1
102 0.09
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.14
112 0.18
113 0.2
114 0.22
115 0.22
116 0.22
117 0.24
118 0.25
119 0.17
120 0.14
121 0.13
122 0.12
123 0.12
124 0.12
125 0.1
126 0.09
127 0.08
128 0.07
129 0.06
130 0.05
131 0.04
132 0.05
133 0.07
134 0.08
135 0.09
136 0.08
137 0.08
138 0.08
139 0.09
140 0.09
141 0.07
142 0.11
143 0.12
144 0.14
145 0.16
146 0.16
147 0.18
148 0.18
149 0.2
150 0.16
151 0.21
152 0.2
153 0.2
154 0.2
155 0.18
156 0.18
157 0.16
158 0.16
159 0.1
160 0.09
161 0.07
162 0.09
163 0.08
164 0.08
165 0.08
166 0.08
167 0.08
168 0.08
169 0.07
170 0.05
171 0.05
172 0.07
173 0.1
174 0.09
175 0.09
176 0.09
177 0.09
178 0.1
179 0.1
180 0.09
181 0.05
182 0.05
183 0.06
184 0.06
185 0.07
186 0.05
187 0.05
188 0.05
189 0.06
190 0.08
191 0.09
192 0.11
193 0.11
194 0.15
195 0.17
196 0.21
197 0.22
198 0.2
199 0.2
200 0.2
201 0.2
202 0.17
203 0.16
204 0.12
205 0.11
206 0.11
207 0.11
208 0.08
209 0.09
210 0.09
211 0.09
212 0.09
213 0.09
214 0.1
215 0.14
216 0.14
217 0.16
218 0.24
219 0.29
220 0.32
221 0.35
222 0.39
223 0.4
224 0.44
225 0.42
226 0.35
227 0.33
228 0.33
229 0.32
230 0.33
231 0.34
232 0.33
233 0.35
234 0.34
235 0.3
236 0.28
237 0.27
238 0.21
239 0.16
240 0.14
241 0.13
242 0.12
243 0.12
244 0.1
245 0.1
246 0.11
247 0.11
248 0.09
249 0.07
250 0.07
251 0.08
252 0.07
253 0.08
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.07
260 0.06
261 0.06
262 0.06
263 0.05
264 0.05
265 0.05
266 0.04
267 0.08
268 0.08
269 0.09
270 0.1
271 0.09
272 0.11
273 0.12
274 0.13
275 0.1
276 0.1
277 0.09
278 0.1
279 0.11
280 0.1
281 0.09
282 0.08
283 0.09
284 0.08
285 0.09
286 0.08
287 0.08
288 0.08
289 0.09
290 0.08
291 0.08
292 0.08
293 0.08
294 0.08
295 0.08
296 0.09
297 0.1
298 0.13
299 0.16
300 0.23
301 0.3
302 0.38
303 0.47
304 0.54
305 0.63
306 0.71
307 0.77
308 0.81
309 0.83
310 0.87
311 0.86
312 0.88
313 0.88
314 0.88
315 0.87
316 0.85