Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2T4I4

Protein Details
Accession A0A2L2T4I4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPKDVKSRKKDRKGLKKEQKSPIIKKPDIBasic
31-54NESPDGRRSHKKKQHSENKESLDTHydrophilic
NLS Segment(s)
PositionSequence
6-43KSRKKDRKGLKKEQKSPIIKKPDIHNESPDGRRSHKKK
Subcellular Location(s) nucl 23, mito_nucl 13.333, cyto_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MPKDVKSRKKDRKGLKKEQKSPIIKKPDIHNESPDGRRSHKKKQHSENKESLDTIRTTLFSLHNSIINKNRTTPIEKQEFCSRMGNLYSNMLELAFELSTTEEDTEMEWQHEPTNIVHLVRTSEEMACYPNGAVVCPWQTASNSNFPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.93
4 0.92
5 0.92
6 0.91
7 0.9
8 0.87
9 0.85
10 0.84
11 0.76
12 0.72
13 0.7
14 0.71
15 0.68
16 0.62
17 0.56
18 0.52
19 0.55
20 0.53
21 0.51
22 0.43
23 0.42
24 0.49
25 0.52
26 0.57
27 0.6
28 0.66
29 0.7
30 0.78
31 0.84
32 0.83
33 0.86
34 0.83
35 0.8
36 0.71
37 0.62
38 0.52
39 0.44
40 0.35
41 0.27
42 0.19
43 0.14
44 0.13
45 0.14
46 0.14
47 0.12
48 0.14
49 0.14
50 0.16
51 0.17
52 0.19
53 0.23
54 0.26
55 0.25
56 0.24
57 0.26
58 0.25
59 0.29
60 0.31
61 0.31
62 0.37
63 0.36
64 0.38
65 0.43
66 0.42
67 0.39
68 0.38
69 0.31
70 0.24
71 0.25
72 0.23
73 0.17
74 0.17
75 0.15
76 0.12
77 0.12
78 0.09
79 0.08
80 0.07
81 0.07
82 0.05
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.05
90 0.06
91 0.06
92 0.09
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.13
99 0.14
100 0.12
101 0.16
102 0.16
103 0.16
104 0.16
105 0.16
106 0.16
107 0.16
108 0.18
109 0.15
110 0.14
111 0.14
112 0.14
113 0.16
114 0.14
115 0.14
116 0.11
117 0.12
118 0.11
119 0.11
120 0.11
121 0.13
122 0.15
123 0.15
124 0.16
125 0.16
126 0.17
127 0.21
128 0.25
129 0.32