Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TXQ5

Protein Details
Accession A0A2L2TXQ5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-60SDKMAPAAKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
39-55AAKKQKKKWSKGKVKDK
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MWWFATLETFILSDRNTTLSLTVVFTLPSTATSDKMAPAAKKQKKKWSKGKVKDKAQHAVVLDKTTSEKLYKDVQSYRLVTIATLVDRMKINGSLARQCLADLEEKGIIKPVVTHSKMKIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.12
6 0.12
7 0.13
8 0.12
9 0.12
10 0.11
11 0.1
12 0.1
13 0.1
14 0.08
15 0.08
16 0.11
17 0.11
18 0.11
19 0.13
20 0.14
21 0.14
22 0.16
23 0.19
24 0.16
25 0.24
26 0.34
27 0.4
28 0.49
29 0.55
30 0.63
31 0.7
32 0.79
33 0.81
34 0.82
35 0.85
36 0.87
37 0.91
38 0.9
39 0.9
40 0.86
41 0.81
42 0.76
43 0.66
44 0.58
45 0.48
46 0.41
47 0.32
48 0.26
49 0.21
50 0.15
51 0.14
52 0.12
53 0.12
54 0.09
55 0.09
56 0.11
57 0.17
58 0.19
59 0.21
60 0.24
61 0.26
62 0.3
63 0.31
64 0.29
65 0.24
66 0.22
67 0.18
68 0.17
69 0.14
70 0.1
71 0.1
72 0.1
73 0.1
74 0.11
75 0.12
76 0.11
77 0.11
78 0.12
79 0.13
80 0.16
81 0.18
82 0.19
83 0.2
84 0.19
85 0.18
86 0.18
87 0.16
88 0.17
89 0.13
90 0.14
91 0.16
92 0.17
93 0.17
94 0.19
95 0.18
96 0.14
97 0.16
98 0.2
99 0.27
100 0.3
101 0.35
102 0.34
103 0.44
104 0.49
105 0.5
106 0.51
107 0.46
108 0.48
109 0.47