Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2THU3

Protein Details
Accession A0A2L2THU3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-31GGTQTGKKKHRPTLKSWKKARKASNSVIMPHydrophilic
NLS Segment(s)
PositionSequence
8-24KKKHRPTLKSWKKARKA
Subcellular Location(s) nucl 18, mito_nucl 14, mito 8
Family & Domain DBs
Amino Acid Sequences MGGTQTGKKKHRPTLKSWKKARKASNSVIMPPIPPTRSSRPNTDEVRTTNKAQATGAATNTKNHAAVIRDVQRKDLNRAQYCDPNTVFAPSAMRQYSWLKQQRSAVGQTNATGTNSMSASGSTNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.86
5 0.87
6 0.86
7 0.88
8 0.88
9 0.87
10 0.85
11 0.82
12 0.81
13 0.73
14 0.66
15 0.6
16 0.51
17 0.41
18 0.36
19 0.33
20 0.24
21 0.23
22 0.27
23 0.3
24 0.39
25 0.42
26 0.46
27 0.46
28 0.52
29 0.54
30 0.51
31 0.48
32 0.43
33 0.47
34 0.43
35 0.4
36 0.36
37 0.33
38 0.31
39 0.26
40 0.25
41 0.21
42 0.19
43 0.18
44 0.18
45 0.18
46 0.18
47 0.19
48 0.18
49 0.14
50 0.13
51 0.13
52 0.11
53 0.12
54 0.17
55 0.23
56 0.27
57 0.28
58 0.31
59 0.34
60 0.34
61 0.39
62 0.39
63 0.4
64 0.39
65 0.42
66 0.43
67 0.45
68 0.45
69 0.44
70 0.39
71 0.32
72 0.29
73 0.27
74 0.24
75 0.18
76 0.19
77 0.15
78 0.19
79 0.17
80 0.17
81 0.19
82 0.23
83 0.26
84 0.33
85 0.41
86 0.38
87 0.43
88 0.48
89 0.51
90 0.51
91 0.52
92 0.49
93 0.45
94 0.44
95 0.4
96 0.37
97 0.32
98 0.28
99 0.23
100 0.16
101 0.15
102 0.14
103 0.14
104 0.11
105 0.11