Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2T1A2

Protein Details
Accession A0A2L2T1A2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
116-137DIAGRRKSGSTPRKRRRPRMRTBasic
NLS Segment(s)
PositionSequence
119-137GRRKSGSTPRKRRRPRMRT
Subcellular Location(s) plas 7E.R. 7, mito 5, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014144  LigD_PE_domain  
Pfam View protein in Pfam  
PF13298  LigD_N  
Amino Acid Sequences MLGVFRVLILSSISITILLQERNRDTNTLPMKTASSSTGSLLIWDTGTYSILQRKSKNSPSEDPSSPPSSPASSLTSTPQALLHEAFQSRKIRIRLHGSHLPDPYVLNLRLTKSEDIAGRRKSGSTPRKRRRPRMRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.11
5 0.13
6 0.15
7 0.2
8 0.23
9 0.27
10 0.29
11 0.28
12 0.27
13 0.33
14 0.38
15 0.35
16 0.33
17 0.3
18 0.3
19 0.29
20 0.29
21 0.21
22 0.17
23 0.16
24 0.15
25 0.16
26 0.15
27 0.14
28 0.13
29 0.12
30 0.09
31 0.08
32 0.08
33 0.06
34 0.07
35 0.07
36 0.08
37 0.12
38 0.17
39 0.21
40 0.23
41 0.27
42 0.34
43 0.42
44 0.46
45 0.47
46 0.48
47 0.49
48 0.52
49 0.49
50 0.44
51 0.4
52 0.38
53 0.32
54 0.28
55 0.24
56 0.19
57 0.18
58 0.18
59 0.17
60 0.14
61 0.15
62 0.16
63 0.17
64 0.16
65 0.16
66 0.15
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.12
73 0.13
74 0.17
75 0.19
76 0.2
77 0.26
78 0.29
79 0.3
80 0.35
81 0.43
82 0.43
83 0.47
84 0.52
85 0.51
86 0.53
87 0.5
88 0.45
89 0.37
90 0.32
91 0.27
92 0.26
93 0.21
94 0.19
95 0.2
96 0.21
97 0.24
98 0.27
99 0.25
100 0.21
101 0.25
102 0.26
103 0.29
104 0.36
105 0.36
106 0.36
107 0.36
108 0.36
109 0.37
110 0.44
111 0.49
112 0.52
113 0.6
114 0.68
115 0.78
116 0.88
117 0.94