Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2T9L3

Protein Details
Accession A0A2L2T9L3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
228-249TSTTAPAKKRKVDEKETKKADNHydrophilic
NLS Segment(s)
PositionSequence
233-265PAKKRKVDEKETKKADNAVKEQPSLRRSKRVKS
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MASSSTIVSADKVSLEEFNQLLLRYPSVIQRISDEKGVKNGQKSLKDLDEYRYSEALDNFDAGKRTRPMTIDDIKTLVEWKLRHGKFRPTLMKLVSSNGPDDAQDVIKQALKIYDEKTDTVATLDVLTKLRGIGPATASLLLAVHDASRVIFFADEAFWWLCCSGKHNPIKYNAKEYRMLCSEVDDLRNRLGVKASDIEKVAYVLIKQPDPTEQSHDAAPVKKEKESTSTTAPAKKRKVDEKETKKADNAVKEQPSLRRSKRVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.14
5 0.16
6 0.17
7 0.16
8 0.18
9 0.18
10 0.17
11 0.16
12 0.17
13 0.2
14 0.23
15 0.25
16 0.22
17 0.26
18 0.3
19 0.3
20 0.35
21 0.33
22 0.3
23 0.35
24 0.42
25 0.41
26 0.41
27 0.46
28 0.47
29 0.48
30 0.5
31 0.48
32 0.46
33 0.45
34 0.43
35 0.41
36 0.42
37 0.4
38 0.4
39 0.35
40 0.31
41 0.31
42 0.3
43 0.26
44 0.19
45 0.18
46 0.15
47 0.16
48 0.18
49 0.16
50 0.2
51 0.2
52 0.21
53 0.23
54 0.23
55 0.26
56 0.31
57 0.38
58 0.35
59 0.34
60 0.33
61 0.31
62 0.29
63 0.26
64 0.2
65 0.17
66 0.14
67 0.19
68 0.28
69 0.29
70 0.36
71 0.39
72 0.47
73 0.48
74 0.58
75 0.59
76 0.53
77 0.57
78 0.51
79 0.52
80 0.43
81 0.4
82 0.33
83 0.27
84 0.24
85 0.2
86 0.18
87 0.14
88 0.14
89 0.12
90 0.1
91 0.09
92 0.09
93 0.09
94 0.11
95 0.11
96 0.1
97 0.11
98 0.11
99 0.13
100 0.14
101 0.17
102 0.17
103 0.17
104 0.18
105 0.17
106 0.16
107 0.14
108 0.13
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.09
126 0.07
127 0.07
128 0.06
129 0.05
130 0.04
131 0.04
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.04
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.07
150 0.12
151 0.15
152 0.24
153 0.31
154 0.36
155 0.4
156 0.48
157 0.57
158 0.55
159 0.6
160 0.56
161 0.53
162 0.54
163 0.51
164 0.48
165 0.42
166 0.41
167 0.31
168 0.29
169 0.28
170 0.24
171 0.28
172 0.23
173 0.22
174 0.21
175 0.24
176 0.21
177 0.19
178 0.19
179 0.16
180 0.17
181 0.2
182 0.21
183 0.21
184 0.21
185 0.21
186 0.18
187 0.18
188 0.15
189 0.11
190 0.1
191 0.13
192 0.15
193 0.16
194 0.16
195 0.17
196 0.21
197 0.23
198 0.25
199 0.27
200 0.27
201 0.28
202 0.28
203 0.3
204 0.3
205 0.31
206 0.32
207 0.33
208 0.32
209 0.33
210 0.35
211 0.34
212 0.37
213 0.38
214 0.4
215 0.38
216 0.43
217 0.46
218 0.51
219 0.55
220 0.58
221 0.6
222 0.63
223 0.65
224 0.68
225 0.72
226 0.75
227 0.8
228 0.81
229 0.84
230 0.84
231 0.79
232 0.72
233 0.71
234 0.66
235 0.64
236 0.6
237 0.58
238 0.56
239 0.56
240 0.57
241 0.57
242 0.57
243 0.58
244 0.58
245 0.6