Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2T8K1

Protein Details
Accession A0A2L2T8K1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-55GSLSYKQSRRDRFKTRRELTRNKIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6golg 6, mito 5, cyto 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MSWMLPDTNSRLQMRGFSFGCKGNDQTVVGNGSLSYKQSRRDRFKTRRELTRNKILLSEDVSVSTMMLREDDRCCVTISDRHGWHRQIGDLGAGFDTIAVLLGLLIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.31
4 0.28
5 0.29
6 0.33
7 0.35
8 0.31
9 0.3
10 0.26
11 0.28
12 0.26
13 0.24
14 0.21
15 0.2
16 0.17
17 0.15
18 0.13
19 0.12
20 0.12
21 0.12
22 0.14
23 0.14
24 0.23
25 0.31
26 0.41
27 0.47
28 0.56
29 0.65
30 0.71
31 0.79
32 0.82
33 0.8
34 0.81
35 0.81
36 0.82
37 0.77
38 0.77
39 0.69
40 0.59
41 0.54
42 0.44
43 0.37
44 0.3
45 0.25
46 0.15
47 0.13
48 0.13
49 0.11
50 0.1
51 0.09
52 0.06
53 0.05
54 0.06
55 0.06
56 0.08
57 0.09
58 0.12
59 0.14
60 0.14
61 0.15
62 0.15
63 0.17
64 0.19
65 0.24
66 0.29
67 0.31
68 0.35
69 0.4
70 0.41
71 0.43
72 0.4
73 0.36
74 0.31
75 0.28
76 0.25
77 0.2
78 0.19
79 0.15
80 0.13
81 0.11
82 0.08
83 0.07
84 0.05
85 0.04
86 0.03
87 0.03