Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TDU2

Protein Details
Accession A0A2L2TDU2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
124-144GSDRGRGRSRGRARGRGRRGNBasic
NLS Segment(s)
PositionSequence
127-144RGRGRSRGRARGRGRRGN
Subcellular Location(s) nucl 13, cyto 7.5, mito_nucl 7.5, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences MCKTSAYFTRCETCKQDIDHCLKVDQNCKNKNRGLPYCSIIYPVNMNIDWATIDQEAKEMAEQPPPKTESDDTLIMKQLVDDIDNRVNMEKHGRVENWLDGHPNVKAGEWFDEVEEDVIEEETGSDRGRGRSRGRARGRGRRGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.5
4 0.5
5 0.55
6 0.55
7 0.51
8 0.46
9 0.45
10 0.46
11 0.47
12 0.46
13 0.49
14 0.53
15 0.56
16 0.61
17 0.62
18 0.64
19 0.65
20 0.64
21 0.59
22 0.55
23 0.53
24 0.49
25 0.44
26 0.4
27 0.3
28 0.24
29 0.21
30 0.18
31 0.17
32 0.14
33 0.14
34 0.11
35 0.11
36 0.1
37 0.09
38 0.1
39 0.07
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.13
49 0.15
50 0.16
51 0.2
52 0.22
53 0.22
54 0.23
55 0.23
56 0.19
57 0.21
58 0.23
59 0.2
60 0.19
61 0.2
62 0.17
63 0.16
64 0.13
65 0.11
66 0.07
67 0.07
68 0.07
69 0.09
70 0.11
71 0.12
72 0.12
73 0.12
74 0.13
75 0.13
76 0.17
77 0.16
78 0.16
79 0.2
80 0.2
81 0.21
82 0.24
83 0.26
84 0.24
85 0.22
86 0.22
87 0.18
88 0.19
89 0.17
90 0.16
91 0.14
92 0.12
93 0.12
94 0.12
95 0.15
96 0.15
97 0.15
98 0.14
99 0.14
100 0.14
101 0.13
102 0.11
103 0.08
104 0.07
105 0.07
106 0.06
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.09
113 0.12
114 0.18
115 0.23
116 0.3
117 0.35
118 0.44
119 0.53
120 0.62
121 0.68
122 0.73
123 0.78
124 0.82