Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2T7Y9

Protein Details
Accession A0A2L2T7Y9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-99NVVPGPPEKPPKRPKRKSTSRRNKTKKPKRWABasic
NLS Segment(s)
PositionSequence
74-99PEKPPKRPKRKSTSRRNKTKKPKRWA
Subcellular Location(s) plas 9, mito 7, extr 7, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDIAIWFRNFLISTLWAIAVSIGRIFGCEKTLKKRLYVAGSRFGLSSWATATTRSATTTETILEWIDNVVPGPPEKPPKRPKRKSTSRRNKTKKPKRWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.12
6 0.09
7 0.08
8 0.07
9 0.06
10 0.06
11 0.07
12 0.08
13 0.08
14 0.1
15 0.14
16 0.17
17 0.25
18 0.33
19 0.34
20 0.34
21 0.38
22 0.4
23 0.44
24 0.47
25 0.42
26 0.42
27 0.42
28 0.4
29 0.36
30 0.31
31 0.25
32 0.18
33 0.15
34 0.08
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.1
47 0.09
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.12
61 0.22
62 0.26
63 0.36
64 0.46
65 0.57
66 0.68
67 0.77
68 0.83
69 0.85
70 0.93
71 0.93
72 0.94
73 0.95
74 0.94
75 0.95
76 0.95
77 0.94
78 0.95
79 0.95