Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2SPX2

Protein Details
Accession A0A2L2SPX2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-33AVVKTQLHWRKRAKRLRTRHLIGPHydrophilic
NLS Segment(s)
PositionSequence
19-25RKRAKRL
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MRKPCVRTAAVVKTQLHWRKRAKRLRTRHLIGPDSLGHCFTRQDRLLQLVGQRTPQQANMMVGPLDGHQILVTSPCIATLGKNVKQAFRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.54
4 0.54
5 0.58
6 0.62
7 0.72
8 0.78
9 0.79
10 0.81
11 0.87
12 0.88
13 0.88
14 0.83
15 0.8
16 0.77
17 0.69
18 0.6
19 0.52
20 0.44
21 0.35
22 0.31
23 0.25
24 0.17
25 0.15
26 0.16
27 0.14
28 0.18
29 0.17
30 0.18
31 0.18
32 0.2
33 0.2
34 0.2
35 0.21
36 0.18
37 0.18
38 0.18
39 0.19
40 0.18
41 0.18
42 0.18
43 0.18
44 0.16
45 0.17
46 0.15
47 0.14
48 0.12
49 0.11
50 0.11
51 0.09
52 0.08
53 0.07
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.16
67 0.24
68 0.28
69 0.35
70 0.37
71 0.4