Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TQP8

Protein Details
Accession A0A2L2TQP8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-46APPMHPKSHKDEVKKLRRRLKHLREQHDELLNBasic
310-333GLVARLVLRRKNRKSSQRLTDSDAHydrophilic
NLS Segment(s)
PositionSequence
24-35KDEVKKLRRRLK
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 3, plas 1, pero 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR005162  Retrotrans_gag_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences MPMNTDDDEEGEIVAPPMHPKSHKDEVKKLRRRLKHLREQHDELLNSARRNATISQGKIERLEEQVGNLTSIAKGLGEEAEKTQRLYKEHIEHTATLVATGKDPGEILRPRQPDSYDGNAEHLQGFLTALRSYQLYYPVQFSTDEMKTRHAMSLLKGKAQRLMEPIVRDYVNNPRHERKDMTRLVYDKYENFEQELIHAFGLANERREAESKIRNLRQTGSAAAYLSEYRYQAAKLDWNESAHMDQVYLGLKEEVKDALVNIRPKPKTLNDLANIVSTTQSTTQSTSSLSTSAKAGITVGSVIGGLGAIGLVARLVLRRKNRKSSQRLTDSDAGKPNEETRYELHDERTHEMHAQNLVELPADYGRVDDRAAAGYDRAYRTFNSGSGLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.14
5 0.18
6 0.21
7 0.25
8 0.33
9 0.43
10 0.5
11 0.55
12 0.63
13 0.69
14 0.78
15 0.83
16 0.85
17 0.84
18 0.86
19 0.87
20 0.88
21 0.88
22 0.88
23 0.88
24 0.88
25 0.87
26 0.85
27 0.82
28 0.78
29 0.67
30 0.58
31 0.56
32 0.51
33 0.43
34 0.39
35 0.33
36 0.26
37 0.29
38 0.28
39 0.28
40 0.32
41 0.33
42 0.37
43 0.39
44 0.4
45 0.39
46 0.39
47 0.33
48 0.28
49 0.3
50 0.23
51 0.22
52 0.25
53 0.23
54 0.22
55 0.2
56 0.17
57 0.13
58 0.13
59 0.11
60 0.06
61 0.06
62 0.06
63 0.08
64 0.08
65 0.09
66 0.12
67 0.18
68 0.19
69 0.2
70 0.25
71 0.26
72 0.28
73 0.32
74 0.37
75 0.4
76 0.43
77 0.47
78 0.45
79 0.42
80 0.41
81 0.39
82 0.31
83 0.23
84 0.22
85 0.16
86 0.13
87 0.14
88 0.12
89 0.09
90 0.09
91 0.09
92 0.14
93 0.17
94 0.21
95 0.27
96 0.3
97 0.32
98 0.36
99 0.36
100 0.33
101 0.37
102 0.39
103 0.35
104 0.33
105 0.35
106 0.32
107 0.31
108 0.27
109 0.21
110 0.14
111 0.1
112 0.1
113 0.07
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.1
121 0.14
122 0.14
123 0.15
124 0.17
125 0.17
126 0.17
127 0.17
128 0.16
129 0.17
130 0.18
131 0.21
132 0.19
133 0.22
134 0.22
135 0.23
136 0.23
137 0.19
138 0.18
139 0.17
140 0.26
141 0.24
142 0.28
143 0.28
144 0.28
145 0.31
146 0.31
147 0.3
148 0.24
149 0.27
150 0.25
151 0.24
152 0.25
153 0.22
154 0.21
155 0.19
156 0.18
157 0.24
158 0.27
159 0.3
160 0.33
161 0.37
162 0.4
163 0.44
164 0.46
165 0.41
166 0.46
167 0.46
168 0.45
169 0.43
170 0.41
171 0.39
172 0.38
173 0.34
174 0.26
175 0.25
176 0.22
177 0.19
178 0.18
179 0.17
180 0.13
181 0.13
182 0.14
183 0.11
184 0.09
185 0.09
186 0.08
187 0.08
188 0.13
189 0.13
190 0.12
191 0.11
192 0.13
193 0.13
194 0.15
195 0.16
196 0.18
197 0.23
198 0.28
199 0.36
200 0.39
201 0.41
202 0.4
203 0.4
204 0.37
205 0.33
206 0.29
207 0.22
208 0.18
209 0.16
210 0.15
211 0.13
212 0.11
213 0.1
214 0.1
215 0.08
216 0.08
217 0.09
218 0.09
219 0.1
220 0.11
221 0.15
222 0.15
223 0.18
224 0.19
225 0.19
226 0.2
227 0.19
228 0.19
229 0.15
230 0.13
231 0.1
232 0.08
233 0.09
234 0.1
235 0.09
236 0.08
237 0.08
238 0.08
239 0.09
240 0.1
241 0.08
242 0.07
243 0.07
244 0.07
245 0.12
246 0.16
247 0.2
248 0.22
249 0.31
250 0.31
251 0.32
252 0.37
253 0.36
254 0.38
255 0.39
256 0.44
257 0.37
258 0.4
259 0.39
260 0.35
261 0.31
262 0.25
263 0.2
264 0.12
265 0.12
266 0.1
267 0.12
268 0.11
269 0.13
270 0.13
271 0.14
272 0.15
273 0.15
274 0.14
275 0.14
276 0.14
277 0.13
278 0.13
279 0.14
280 0.13
281 0.11
282 0.11
283 0.09
284 0.09
285 0.08
286 0.07
287 0.05
288 0.05
289 0.05
290 0.04
291 0.03
292 0.03
293 0.02
294 0.02
295 0.02
296 0.02
297 0.02
298 0.02
299 0.02
300 0.03
301 0.05
302 0.09
303 0.16
304 0.26
305 0.37
306 0.46
307 0.57
308 0.67
309 0.75
310 0.82
311 0.86
312 0.87
313 0.86
314 0.81
315 0.78
316 0.75
317 0.67
318 0.63
319 0.6
320 0.52
321 0.43
322 0.42
323 0.38
324 0.36
325 0.34
326 0.31
327 0.26
328 0.32
329 0.36
330 0.36
331 0.38
332 0.38
333 0.4
334 0.41
335 0.41
336 0.35
337 0.34
338 0.32
339 0.3
340 0.3
341 0.26
342 0.23
343 0.22
344 0.2
345 0.17
346 0.16
347 0.14
348 0.11
349 0.11
350 0.1
351 0.1
352 0.11
353 0.12
354 0.12
355 0.11
356 0.12
357 0.13
358 0.15
359 0.15
360 0.14
361 0.16
362 0.22
363 0.24
364 0.25
365 0.24
366 0.24
367 0.29
368 0.3
369 0.28
370 0.27