Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2TV55

Protein Details
Accession A0A2L2TV55    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-64GGALKLKGAKINKKKKKRDKTDLEKNLDTGSKDEEKRKRKKKDGDDEPRHEDDBasic
NLS Segment(s)
PositionSequence
16-53KLKGAKINKKKKKRDKTDLEKNLDTGSKDEEKRKRKKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGSDDYAAVGGGGALKLKGAKINKKKKKRDKTDLEKNLDTGSKDEEKRKRKKKDGDDEPRHEDDEEKPEVQKTESQKRHEEIKKKRLLQLAESSGSRPELLKTHKERVEELNTYLSKLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.13
6 0.2
7 0.31
8 0.41
9 0.53
10 0.63
11 0.73
12 0.83
13 0.89
14 0.93
15 0.93
16 0.94
17 0.94
18 0.94
19 0.94
20 0.93
21 0.89
22 0.79
23 0.69
24 0.6
25 0.51
26 0.4
27 0.3
28 0.25
29 0.24
30 0.26
31 0.33
32 0.4
33 0.48
34 0.58
35 0.67
36 0.72
37 0.76
38 0.83
39 0.85
40 0.87
41 0.89
42 0.89
43 0.89
44 0.85
45 0.81
46 0.73
47 0.63
48 0.51
49 0.42
50 0.33
51 0.28
52 0.24
53 0.18
54 0.17
55 0.17
56 0.17
57 0.17
58 0.19
59 0.21
60 0.29
61 0.35
62 0.39
63 0.43
64 0.44
65 0.53
66 0.56
67 0.6
68 0.59
69 0.63
70 0.67
71 0.67
72 0.7
73 0.66
74 0.61
75 0.56
76 0.54
77 0.48
78 0.42
79 0.39
80 0.34
81 0.29
82 0.28
83 0.23
84 0.15
85 0.12
86 0.16
87 0.21
88 0.3
89 0.35
90 0.43
91 0.46
92 0.48
93 0.49
94 0.5
95 0.53
96 0.46
97 0.42
98 0.41
99 0.38
100 0.37
101 0.34
102 0.27
103 0.2
104 0.19
105 0.2
106 0.19
107 0.21
108 0.26
109 0.32
110 0.33