Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2THA4

Protein Details
Accession A0A2L2THA4    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-205RQSNVDRRKSKCNQRSKRKPGTVQGQRKSKRPRNEVDYDEHydrophilic
NLS Segment(s)
PositionSequence
176-176K
178-198NQRSKRKPGTVQGQRKSKRPR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, vacu 2
Family & Domain DBs
Amino Acid Sequences MAMEHYQGSTNIYDISYRRIGDRDILPKDPKLASLYLVQTEYLGSTYPTSTSELRHAQDSQFPDNRTEIDLLRNAENITFFDLGIKGNSWAQVPMKDRNWPCSSLPLLEKGWQNRTNDTELGSTDVETDISQTNQVVSTPAHHERAGDKLFDALTKAATLVAHFLRQSNVDRRKSKCNQRSKRKPGTVQGQRKSKRPRNEVDYDESMACHDGSEPVSDDGDDYVKFDPGHQLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.21
4 0.22
5 0.23
6 0.24
7 0.25
8 0.28
9 0.35
10 0.38
11 0.39
12 0.44
13 0.46
14 0.45
15 0.48
16 0.42
17 0.37
18 0.32
19 0.28
20 0.23
21 0.25
22 0.26
23 0.24
24 0.24
25 0.21
26 0.18
27 0.17
28 0.15
29 0.1
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.1
36 0.12
37 0.13
38 0.15
39 0.2
40 0.24
41 0.25
42 0.28
43 0.28
44 0.26
45 0.31
46 0.33
47 0.34
48 0.34
49 0.34
50 0.33
51 0.32
52 0.32
53 0.28
54 0.26
55 0.19
56 0.18
57 0.2
58 0.2
59 0.2
60 0.2
61 0.18
62 0.16
63 0.16
64 0.13
65 0.13
66 0.11
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.11
79 0.15
80 0.18
81 0.23
82 0.24
83 0.31
84 0.32
85 0.37
86 0.38
87 0.36
88 0.33
89 0.32
90 0.32
91 0.27
92 0.27
93 0.23
94 0.22
95 0.23
96 0.25
97 0.23
98 0.29
99 0.31
100 0.31
101 0.3
102 0.32
103 0.31
104 0.28
105 0.26
106 0.2
107 0.16
108 0.16
109 0.14
110 0.11
111 0.09
112 0.09
113 0.07
114 0.06
115 0.08
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.08
126 0.13
127 0.15
128 0.17
129 0.17
130 0.18
131 0.18
132 0.24
133 0.23
134 0.19
135 0.16
136 0.15
137 0.15
138 0.14
139 0.15
140 0.09
141 0.08
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.09
148 0.09
149 0.1
150 0.1
151 0.11
152 0.12
153 0.14
154 0.19
155 0.26
156 0.35
157 0.42
158 0.48
159 0.52
160 0.61
161 0.68
162 0.74
163 0.73
164 0.76
165 0.78
166 0.83
167 0.91
168 0.91
169 0.93
170 0.91
171 0.89
172 0.87
173 0.87
174 0.86
175 0.85
176 0.83
177 0.83
178 0.77
179 0.79
180 0.81
181 0.79
182 0.79
183 0.77
184 0.78
185 0.76
186 0.8
187 0.76
188 0.73
189 0.68
190 0.61
191 0.52
192 0.42
193 0.35
194 0.28
195 0.22
196 0.14
197 0.1
198 0.1
199 0.1
200 0.13
201 0.14
202 0.14
203 0.15
204 0.15
205 0.15
206 0.14
207 0.15
208 0.13
209 0.12
210 0.12
211 0.14
212 0.15
213 0.15
214 0.22
215 0.23