Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2T480

Protein Details
Accession A0A2L2T480    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRNKEHKRADAAGBasic
NLS Segment(s)
PositionSequence
5-20KKDRRNKEHKRADAAG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRRNKEHKRADAAGTRAPVKANGLPVKAPKPTSICQNCRKEIVNTNKLQLEVHAETHDAKLWPKEKCWPNDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.76
4 0.72
5 0.64
6 0.57
7 0.49
8 0.42
9 0.35
10 0.31
11 0.25
12 0.21
13 0.2
14 0.22
15 0.23
16 0.23
17 0.24
18 0.26
19 0.29
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.54
30 0.53
31 0.51
32 0.52
33 0.46
34 0.47
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.2
45 0.2
46 0.18
47 0.17
48 0.18
49 0.19
50 0.21
51 0.16
52 0.16
53 0.22
54 0.27
55 0.29
56 0.31
57 0.4
58 0.46
59 0.54