Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2SNH8

Protein Details
Accession A0A2L2SNH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65EVPTRKRAIAQQKQQQQQKKKYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 6, plas 4, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MKFQLFTLIALVSAASAGLIKRVDVNVPAMTDAQGNVVAFNAAEVPTRKRAIAQQKQQQQQKKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.06
6 0.06
7 0.06
8 0.08
9 0.08
10 0.09
11 0.1
12 0.12
13 0.11
14 0.11
15 0.12
16 0.1
17 0.1
18 0.1
19 0.09
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.06
31 0.08
32 0.12
33 0.17
34 0.19
35 0.19
36 0.2
37 0.28
38 0.38
39 0.46
40 0.53
41 0.58
42 0.66
43 0.75
44 0.82
45 0.84