Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2L2THH2

Protein Details
Accession A0A2L2THH2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-49IPNLKDRLPKLEPRKRRSGPSNPTPIPHydrophilic
NLS Segment(s)
PositionSequence
33-39LEPRKRR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004327  Phstyr_phstse_ac  
IPR043170  PTPA_C_lid  
IPR037218  PTPA_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0019211  F:phosphatase activator activity  
Pfam View protein in Pfam  
PF03095  PTPA  
CDD cd04087  PTPA  
Amino Acid Sequences MTSQAPPKPASSPGAAAPISSSIPNLKDRLPKLEPRKRRSGPSNPTPIPETPALPTPPDTSSNWTFKTPSRRILSKKDHDIFLSSSTCKLITAWVFGLAESVIDTPNSAIREADLSGPIKTIIHILDETEQLVTKSPPDEQGGSRFGNKAFRGLLDLAQKNSAAWHRDIGVQNEDAINELSTYFCESFGNGNRIDYGSGHELNFMIWLLCLYQLGLLKQSDFKPIVLRVFVRYLEVMRVIQMTYYLEPAGSHGVWGLDDYQFLPFLFGATQLLHHPYITPRAIHQDLALEEFGHDYMYLGQVSFVNSTKTVKGLRWHSPMLDDISSARSWTKIDGGMRRMFIAEVLGKLPVMQHFLFGSLVPADDSMSEDTGAEDEADVEDDPHAGHDHTGKAHDGTGWGDCCGIKVPSSIAAAQEMKKRGMNQGLRRIPFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.28
4 0.25
5 0.23
6 0.21
7 0.18
8 0.17
9 0.15
10 0.19
11 0.23
12 0.24
13 0.28
14 0.35
15 0.38
16 0.46
17 0.48
18 0.55
19 0.62
20 0.7
21 0.74
22 0.74
23 0.82
24 0.79
25 0.82
26 0.82
27 0.82
28 0.82
29 0.82
30 0.84
31 0.75
32 0.73
33 0.68
34 0.59
35 0.53
36 0.45
37 0.37
38 0.28
39 0.32
40 0.31
41 0.28
42 0.29
43 0.27
44 0.27
45 0.29
46 0.28
47 0.29
48 0.34
49 0.39
50 0.38
51 0.38
52 0.37
53 0.4
54 0.49
55 0.47
56 0.5
57 0.51
58 0.57
59 0.61
60 0.7
61 0.74
62 0.73
63 0.78
64 0.74
65 0.68
66 0.62
67 0.58
68 0.49
69 0.43
70 0.38
71 0.28
72 0.24
73 0.23
74 0.21
75 0.18
76 0.16
77 0.17
78 0.14
79 0.17
80 0.16
81 0.18
82 0.18
83 0.17
84 0.18
85 0.12
86 0.1
87 0.08
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.09
94 0.1
95 0.1
96 0.09
97 0.09
98 0.11
99 0.12
100 0.13
101 0.13
102 0.13
103 0.13
104 0.14
105 0.14
106 0.12
107 0.11
108 0.12
109 0.09
110 0.1
111 0.09
112 0.1
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.09
119 0.1
120 0.09
121 0.09
122 0.1
123 0.11
124 0.13
125 0.16
126 0.18
127 0.18
128 0.23
129 0.25
130 0.26
131 0.26
132 0.25
133 0.24
134 0.28
135 0.26
136 0.24
137 0.21
138 0.19
139 0.21
140 0.2
141 0.23
142 0.24
143 0.25
144 0.24
145 0.24
146 0.23
147 0.2
148 0.21
149 0.21
150 0.16
151 0.15
152 0.16
153 0.16
154 0.22
155 0.24
156 0.24
157 0.23
158 0.2
159 0.2
160 0.19
161 0.18
162 0.13
163 0.11
164 0.08
165 0.06
166 0.06
167 0.05
168 0.05
169 0.08
170 0.07
171 0.07
172 0.07
173 0.08
174 0.11
175 0.15
176 0.18
177 0.16
178 0.16
179 0.16
180 0.16
181 0.16
182 0.13
183 0.11
184 0.12
185 0.13
186 0.13
187 0.13
188 0.12
189 0.12
190 0.12
191 0.09
192 0.05
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.03
199 0.05
200 0.06
201 0.06
202 0.08
203 0.08
204 0.09
205 0.12
206 0.13
207 0.15
208 0.15
209 0.15
210 0.16
211 0.18
212 0.18
213 0.17
214 0.17
215 0.15
216 0.16
217 0.16
218 0.14
219 0.13
220 0.12
221 0.11
222 0.12
223 0.1
224 0.08
225 0.08
226 0.07
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.07
233 0.06
234 0.06
235 0.07
236 0.09
237 0.08
238 0.07
239 0.07
240 0.07
241 0.07
242 0.07
243 0.07
244 0.05
245 0.06
246 0.06
247 0.06
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.07
258 0.07
259 0.1
260 0.1
261 0.1
262 0.11
263 0.11
264 0.17
265 0.18
266 0.17
267 0.16
268 0.22
269 0.24
270 0.23
271 0.22
272 0.19
273 0.18
274 0.2
275 0.19
276 0.12
277 0.11
278 0.11
279 0.11
280 0.07
281 0.07
282 0.05
283 0.05
284 0.06
285 0.07
286 0.06
287 0.07
288 0.07
289 0.09
290 0.1
291 0.1
292 0.1
293 0.11
294 0.13
295 0.13
296 0.16
297 0.17
298 0.18
299 0.24
300 0.29
301 0.37
302 0.4
303 0.41
304 0.39
305 0.39
306 0.38
307 0.35
308 0.28
309 0.21
310 0.16
311 0.18
312 0.17
313 0.16
314 0.14
315 0.11
316 0.11
317 0.12
318 0.14
319 0.15
320 0.21
321 0.27
322 0.32
323 0.35
324 0.35
325 0.34
326 0.32
327 0.28
328 0.22
329 0.19
330 0.15
331 0.12
332 0.12
333 0.12
334 0.11
335 0.11
336 0.12
337 0.11
338 0.14
339 0.13
340 0.13
341 0.13
342 0.15
343 0.15
344 0.14
345 0.14
346 0.09
347 0.09
348 0.08
349 0.08
350 0.07
351 0.07
352 0.09
353 0.09
354 0.1
355 0.1
356 0.09
357 0.1
358 0.1
359 0.1
360 0.08
361 0.06
362 0.06
363 0.06
364 0.07
365 0.07
366 0.07
367 0.07
368 0.07
369 0.07
370 0.08
371 0.09
372 0.08
373 0.1
374 0.13
375 0.16
376 0.17
377 0.2
378 0.2
379 0.2
380 0.21
381 0.2
382 0.18
383 0.17
384 0.2
385 0.19
386 0.17
387 0.17
388 0.16
389 0.17
390 0.18
391 0.17
392 0.14
393 0.14
394 0.16
395 0.18
396 0.21
397 0.21
398 0.19
399 0.23
400 0.26
401 0.29
402 0.35
403 0.34
404 0.35
405 0.38
406 0.39
407 0.41
408 0.48
409 0.53
410 0.55
411 0.63
412 0.69