Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2ST12

Protein Details
Accession A0A2L2ST12    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69DENGRRLRWRRKDANPKVEDBasic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 5, E.R. 5, golg 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPLLHPKSRMTSSLFATTVAACFIVVTIPHMLPCPVPRARFADGDIMVDENGRRLRWRRKDANPKVEDGIVQFNDVSTEESENAHDRAKRECPLPKPGGVLGEWLGFHKNDNEAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.32
4 0.3
5 0.27
6 0.21
7 0.17
8 0.13
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.07
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.12
22 0.17
23 0.18
24 0.19
25 0.22
26 0.26
27 0.29
28 0.28
29 0.28
30 0.28
31 0.25
32 0.24
33 0.22
34 0.17
35 0.14
36 0.13
37 0.11
38 0.08
39 0.09
40 0.08
41 0.11
42 0.16
43 0.27
44 0.36
45 0.45
46 0.51
47 0.6
48 0.72
49 0.79
50 0.83
51 0.75
52 0.68
53 0.61
54 0.52
55 0.42
56 0.32
57 0.27
58 0.17
59 0.15
60 0.13
61 0.11
62 0.11
63 0.11
64 0.12
65 0.08
66 0.09
67 0.09
68 0.1
69 0.12
70 0.13
71 0.14
72 0.16
73 0.17
74 0.17
75 0.22
76 0.27
77 0.29
78 0.33
79 0.39
80 0.41
81 0.48
82 0.51
83 0.48
84 0.46
85 0.44
86 0.41
87 0.33
88 0.31
89 0.22
90 0.2
91 0.18
92 0.16
93 0.17
94 0.14
95 0.16
96 0.16
97 0.17