Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2T7D2

Protein Details
Accession A0A2L2T7D2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-80LMRTRRSFLRKKRRTLNHGRITPHydrophilic
NLS Segment(s)
PositionSequence
66-71LRKKRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSSSIANSGSIKPRREPRDTGFPEPLNNLRNTTLPHPDADLSPNACLTQEDIDPDRALMRTRRSFLRKKRRTLNHGRITPASEALYSAYSLAQSDVGDHDSLRTSTTTNPSLISVRPTTPSIRVSRDETDSLASRTTRRGDEDTPPTSPDVPSHRSKKGFLSKWRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.63
4 0.6
5 0.65
6 0.68
7 0.68
8 0.66
9 0.6
10 0.56
11 0.53
12 0.51
13 0.44
14 0.39
15 0.34
16 0.28
17 0.29
18 0.3
19 0.3
20 0.32
21 0.28
22 0.28
23 0.27
24 0.27
25 0.26
26 0.25
27 0.25
28 0.19
29 0.18
30 0.17
31 0.15
32 0.14
33 0.13
34 0.12
35 0.11
36 0.1
37 0.12
38 0.14
39 0.15
40 0.15
41 0.15
42 0.15
43 0.13
44 0.15
45 0.16
46 0.22
47 0.24
48 0.27
49 0.34
50 0.41
51 0.49
52 0.58
53 0.65
54 0.66
55 0.7
56 0.78
57 0.8
58 0.82
59 0.84
60 0.84
61 0.81
62 0.76
63 0.71
64 0.62
65 0.55
66 0.46
67 0.36
68 0.25
69 0.16
70 0.12
71 0.1
72 0.09
73 0.07
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.05
82 0.05
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.11
93 0.16
94 0.17
95 0.17
96 0.17
97 0.18
98 0.19
99 0.19
100 0.2
101 0.17
102 0.16
103 0.18
104 0.2
105 0.2
106 0.22
107 0.27
108 0.27
109 0.29
110 0.32
111 0.34
112 0.35
113 0.37
114 0.35
115 0.31
116 0.3
117 0.28
118 0.26
119 0.24
120 0.21
121 0.19
122 0.22
123 0.25
124 0.24
125 0.27
126 0.31
127 0.32
128 0.39
129 0.45
130 0.44
131 0.42
132 0.41
133 0.39
134 0.35
135 0.32
136 0.29
137 0.28
138 0.3
139 0.37
140 0.42
141 0.48
142 0.51
143 0.53
144 0.58
145 0.62
146 0.65
147 0.67