Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2L2TF44

Protein Details
Accession A0A2L2TF44    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
378-397TDISMTVKRGKRNMRRAQRSHydrophilic
NLS Segment(s)
PositionSequence
386-394RGKRNMRRA
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF03443  AA9  
Amino Acid Sequences MFAKAFTIATLASYASAHMLMANPKPYGNPGNAPLDANGADFPCKGQVNDGSSSNTYKAGSTQQLSFIGSAVHGGGSCQVSLTTDKNPTKDSVWKVIHSIEGGCPAKNQAGNYPENASAENPDKYDFKIPEELAAGDYVLAWTWFNHVGNREMYMNCAAVNIEGQGGSEGYLDSLPDMFVANIGNDCETPADTDLAFPNPGSSVSKLKSLLTDPKGPGCQKPGSGSGGGSPEPSTPAAAPTSDTGAQPTEPATTPTPGDGSNGAPEIPGGAFITVSQPAASQPSATQAPEAPVTPETPDNGSGEGAGSDEGAGSDGGNDGGNSGPGSGSGGFAAGTACTSEGEWNCIGGSSFQRCASGTWTPSQGLSSGVTCTPGQGTDISMTVKRGKRNMRRAQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.1
7 0.14
8 0.18
9 0.22
10 0.21
11 0.22
12 0.23
13 0.27
14 0.29
15 0.29
16 0.29
17 0.3
18 0.36
19 0.36
20 0.36
21 0.32
22 0.3
23 0.26
24 0.22
25 0.19
26 0.14
27 0.15
28 0.13
29 0.14
30 0.16
31 0.17
32 0.16
33 0.19
34 0.24
35 0.27
36 0.31
37 0.32
38 0.31
39 0.31
40 0.34
41 0.3
42 0.26
43 0.22
44 0.19
45 0.19
46 0.21
47 0.25
48 0.25
49 0.25
50 0.27
51 0.28
52 0.28
53 0.26
54 0.2
55 0.15
56 0.12
57 0.11
58 0.08
59 0.07
60 0.06
61 0.06
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.09
68 0.12
69 0.15
70 0.16
71 0.25
72 0.28
73 0.3
74 0.32
75 0.33
76 0.34
77 0.39
78 0.4
79 0.41
80 0.41
81 0.4
82 0.4
83 0.39
84 0.37
85 0.3
86 0.26
87 0.17
88 0.22
89 0.22
90 0.2
91 0.19
92 0.19
93 0.22
94 0.22
95 0.22
96 0.19
97 0.24
98 0.25
99 0.27
100 0.28
101 0.26
102 0.24
103 0.24
104 0.19
105 0.17
106 0.19
107 0.19
108 0.16
109 0.17
110 0.17
111 0.19
112 0.25
113 0.22
114 0.22
115 0.27
116 0.26
117 0.26
118 0.26
119 0.25
120 0.19
121 0.18
122 0.14
123 0.08
124 0.08
125 0.06
126 0.04
127 0.04
128 0.04
129 0.04
130 0.06
131 0.08
132 0.09
133 0.11
134 0.13
135 0.16
136 0.16
137 0.18
138 0.18
139 0.16
140 0.17
141 0.16
142 0.15
143 0.11
144 0.11
145 0.09
146 0.07
147 0.07
148 0.06
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.07
179 0.06
180 0.07
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.07
188 0.08
189 0.09
190 0.12
191 0.13
192 0.16
193 0.16
194 0.16
195 0.17
196 0.19
197 0.25
198 0.24
199 0.29
200 0.27
201 0.29
202 0.33
203 0.33
204 0.32
205 0.29
206 0.27
207 0.23
208 0.25
209 0.24
210 0.22
211 0.22
212 0.2
213 0.17
214 0.17
215 0.16
216 0.14
217 0.12
218 0.1
219 0.11
220 0.11
221 0.1
222 0.08
223 0.09
224 0.09
225 0.09
226 0.09
227 0.08
228 0.11
229 0.12
230 0.11
231 0.11
232 0.11
233 0.11
234 0.11
235 0.11
236 0.1
237 0.09
238 0.12
239 0.13
240 0.13
241 0.13
242 0.14
243 0.14
244 0.12
245 0.13
246 0.12
247 0.11
248 0.11
249 0.11
250 0.1
251 0.09
252 0.09
253 0.08
254 0.07
255 0.07
256 0.05
257 0.05
258 0.05
259 0.05
260 0.07
261 0.07
262 0.07
263 0.07
264 0.07
265 0.07
266 0.1
267 0.1
268 0.09
269 0.08
270 0.13
271 0.14
272 0.14
273 0.15
274 0.13
275 0.15
276 0.15
277 0.16
278 0.13
279 0.13
280 0.13
281 0.14
282 0.15
283 0.14
284 0.15
285 0.16
286 0.15
287 0.15
288 0.14
289 0.12
290 0.11
291 0.1
292 0.08
293 0.06
294 0.05
295 0.04
296 0.04
297 0.04
298 0.05
299 0.04
300 0.04
301 0.04
302 0.05
303 0.05
304 0.05
305 0.05
306 0.05
307 0.05
308 0.06
309 0.06
310 0.06
311 0.05
312 0.05
313 0.08
314 0.07
315 0.07
316 0.07
317 0.07
318 0.07
319 0.07
320 0.07
321 0.05
322 0.05
323 0.05
324 0.05
325 0.06
326 0.06
327 0.12
328 0.12
329 0.16
330 0.16
331 0.16
332 0.16
333 0.16
334 0.16
335 0.13
336 0.18
337 0.19
338 0.22
339 0.23
340 0.24
341 0.25
342 0.26
343 0.28
344 0.29
345 0.27
346 0.28
347 0.3
348 0.29
349 0.29
350 0.29
351 0.24
352 0.19
353 0.18
354 0.15
355 0.15
356 0.14
357 0.16
358 0.15
359 0.16
360 0.15
361 0.14
362 0.14
363 0.13
364 0.14
365 0.13
366 0.15
367 0.17
368 0.17
369 0.2
370 0.28
371 0.32
372 0.37
373 0.44
374 0.53
375 0.61
376 0.7
377 0.78