Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316UYV6

Protein Details
Accession A0A316UYV6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26ILNAVPKKKVSHSRKRMRAANKGLKDHydrophilic
NLS Segment(s)
PositionSequence
7-23KKKVSHSRKRMRAANKG
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences ILNAVPKKKVSHSRKRMRAANKGLKDRMDLVHCGGCGRPKAIHHICPHCFGDIARRQKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.84
5 0.84
6 0.83
7 0.82
8 0.78
9 0.76
10 0.7
11 0.62
12 0.55
13 0.47
14 0.4
15 0.31
16 0.25
17 0.19
18 0.18
19 0.17
20 0.16
21 0.14
22 0.15
23 0.14
24 0.15
25 0.15
26 0.15
27 0.25
28 0.3
29 0.36
30 0.41
31 0.48
32 0.49
33 0.52
34 0.52
35 0.43
36 0.39
37 0.33
38 0.35
39 0.36